Logout succeed
Logout succeed. See you again!
View - Development PDF
Preview View - Development
Development 128, 1793-1804 (2001) 1793 Printed in Great Britain ©The Company of Biologists Limited 2001 DEV7855 REF-1, a protein with two bHLH domains, alters the pattern of cell fusion in C.elegansby regulating Hox protein activity Scott Alper* and Cynthia Kenyon Department of Biochemistry and Biophysics, University of California, San Francisco, 513 Parnassus Avenue, San Francisco, CA 94143-0448, USA *Author for correspondence (e-mail: [email protected]) Accepted 23 February; published on WWW 19 April 2001 SUMMARY Hox genes control the choice of cell fates along the normally only affects the male Pn.p fusion pattern. Here anteroposterior (AP) body axis of many organisms. In C. we identify a gene, ref-1, that regulates the hermaphrodite elegans, two Hox genes, lin-39 and mab-5, control the cell Pn.p cell fusion pattern largely by regulating MAB-5 fusion decision of the 12 ventrally located Pn.p cells. activity in these cells. Mutation of ref-1also affects the fate Specific Pn.p cells fuse with an epidermal syncytium, hyp7, of other epidermal cells in distinct AP body regions. ref-1 in a sexually dimorphic pattern. In hermaphrodites, Pn.p encodes a protein with two basic helix-loop-helix domains cells in the mid-body region remain unfused whereas in distantly related to those of the hairy/Enhancer of split males, Pn.p cells adopt an alternating pattern of syncytial family. ref-1, and another hairy homolog, lin-22, regulate and unfused fates. The complexity of these fusion patterns similar cell fate decisions in different body regions along arises because the activities of these two Hox proteins are the C. elegans AP body axis. regulated in a sex-specific manner. MAB-5 activity is inhibited in hermaphrodite Pn.p cells and thus MAB-5 Key words: C. elegans, ref-1, Hox genes, Cell fusion, hairy, E(spl) INTRODUCTION 39 and mab-5, homologs of Drosophila labial, Sex combs reduced and Antennapedia, respectively, and egl-5, php-3 and How individual cells interact to coordinate the formation of nob-1, three Abdominal-Bhomologs (Brunschwig et al., 1999; complex tissues is a fundamental biological question. Much of Chisholm, 1991; Clark et al., 1993; van Auken et al., 2000; the C. elegans epidermal layer, the hypodermis, is composed Wang et al., 1993). In C. elegans, as in other organisms, the of several multinucleate cells (syncytia) that are formed by Hox genes regulate the choice of cell fates along the AP body the fusion of mononucleate cells throughout embryonic and axis (Krumlauf, 1994; Lawrence and Morata, 1994; McGinnis postembryonic development (Podbilewicz and White, 1994; and Krumlauf, 1992). However, the simple Hox gene Shemer and Podbilewicz, 2000; Sulston and Horvitz, 1977). expression pattern in C. elegans is insufficient to explain the One such syncytium, hyp7, extends over most of the length of complex Pn.p cell fusion pattern. This is due to the sex- the worm and contains 133 nuclei, close to 15% of all somatic specific, post-translational regulation of two Hox genes, lin-39 nuclei in the worm. How is the fusion of all these cells and mab-5(Salser et al., 1993). In hermaphrodites, MAB-5 is coordinately regulated to allow formation of hyp7? Genes that inactive and only LIN-39 influences Pn.p cell fusion fate. In affect fusion of epidermal cells during C. elegansdevelopment males, both LIN-39 and MAB-5 are active, but the two proteins include those that provide temporal information (heterochronic interact in an unusual way to control cell fusion. It is quite genes; Ambros and Horvitz, 1984; Bettinger et al., 1997), likely that in most species, Hox proteins interact with each determine polarity of certain cell divisions (such as egl-20, lin- other and with other factors to generate more complexity than 44 and cam-1; Forrester et al., 1999; Herman and Horvitz, their expression patterns alone would allow (Duncan, 1996). 1994; Whangbo et al., 2000) and control anteroposterior (AP) Understanding how these interactions modulate Hox protein cell fate (genes of the C. elegans Hox cluster). In this study, activity is therefore necessary to understand fully how an we focus on genes that regulate cell fusion in a position- animal body plan is laid out. specific manner along the AP body axis. At the end of the first larval stage, some of the 12 Pn.p cells To understand how the hyp7 syncytium is generated, we fuse with the hyp7 syncytium in a sex-specific pattern. In have been studying the regulation of the fusion decision of one hermaphrodites, anterior (P1.p and P2.p) and posterior P(9- group of cells called the Pn.p cells that line the ventral surface 11).p cells fuse with the hyp7 syncytium while the six central of the worm during the first larval stage (L1) (Fig. 1A). Pn.p cells P(3-8).p remain unfused (Fig. 1B; Sulston and Horvitz, cell fusion is regulated by two genes of the C. elegans Hox 1977). These six unfused cells, the vulval precursor cells, gene cluster. The Hox cluster consists of six genes: ceh-13, lin- remain competent to develop further, and some of these cells 1794 S. Alper and C. Kenyon generate the hermaphrodite vulva later in development MATERIALS AND METHODS (Sulston and Horvitz, 1977; Sulston and White, 1980). The Pn.p cell fusion pattern is different in males, with P1.p, P2.p, Worm strains and construction of ref-1; Hoxdouble P7.p and P8.p fusing with hyp7 and P(3-6).p and P(9-11).p mutants remaining unfused (Fig. 1C; Kenyon, 1986; Sulston and Standard worm culture and genetic techniques were used (Brenner, Horvitz, 1977; Sulston et al., 1980). The posterior unfused 1974; Wood, 1988). All experiments were carried out at 20°C. Strains used in this study [alleles referenced in Hodgkin, 1997, or as described cells generate male-specific copulatory structures later in below] are: N2 wild-type var. Bristol, CF121: unc-4(e120) bli-1(e769) development (Sulston and Horvitz, 1977; Sulston et al., 1980). II, SP635: mnDf66/mnc1 dpy-10(e128) unc-52(e444) II, SP619: Two Hox genes, lin-39 and mab-5, are known to influence mnDf57/mnc1 dpy-10(e128) unc-52(e444) II, SP719: mnDf83/mnc1 Pn.p cell fusion. lin-39 is expressed in P(3-8).p in both dpy-10(e128) unc-52(e444) II, SP542: mnDf29/mnc1 dpy-10(e128) hermaphrodites and males (Fig. 1; Maloof and Kenyon, 1998; unc-52(e444) II, SP629: mnDf59/mnc1 dpy-10(e128) unc-52(e444) II, Wang et al., 1993). In hermaphrodites, lin-39 prevents fusion SP645: mnDf63/mnc1 dpy-10(e128) unc-52(e444) II (Sigurdson et al., of those Pn.p cells in which it is expressed and therefore P(3- 1984), CF262: lin-39(n1760)/qC1 dpy-19(e1259) glp-1(q339) III; 8).p remain unfused (Fig. 1B; Clark et al., 1993; Wang et al., him-5(e1490) V, CF911: mab-5(e2088) III, TU202: egl-5(u202) III, 1993). Thus, in a lin-39 mutant, all hermaphrodite Pn.p cells CF398: lin-39(n1760) mab-5(e1239)/qC1 dpy-19(e1259) glp-1(q339) fuse with the hyp7 syncytium and are unable to generate a III, CF311: mab-5(e1239) egl-5(n945) III; him-5(e1490) V (Chisholm, 1991), MT7238: lin-39(n1760) mab-5(e1239) egl- vulva. The regulation of Pn.p cell fusion in males is more 5(n945)/sma-3(e491) mab-5(e1239) egl-5(n945) III (from A. complex because both lin-39 and mab-5 can affect the fusion Chisolm), CB3256: mab-5(e1751) III, MT688: lin-12(n137)/unc- decision. mab-5 is expressed in P(7-11).p in both sexes, but 32(e189)III; him-5(e1467)V, CF26: lin-22(mu2)IV; him-5(e1490)V, only functions in males (Salser et al., 1993; Wang et al., 1993). him-5(e1490) V, and the STS mapping strain RW7000 (Williams et Acting alone, either Hox gene is able to prevent fusion of those al., 1992). The him-5 mutation causes worms to generate male cells within which it is expressed: P(3-6).p for lin-39and P(9- progeny at high frequency (Hodgkin et al., 1979). 11).p for mab-5 (Fig. 1C). However, when cells express both To construct strains containing both ref-1(mu220)and the various Hox genes (P7.p and P8.p), those cells fuse with hyp7, much Hox single, double, and triple mutations, ref-1(mu220) was crossed like cells that contain neither Hox gene (P1.p and P2.p) (Fig. to the various Hox mutant strains, and animals homozygous for the 1C). The ability of these two Hox genes to negate each other’s mu220 allele were first recovered in the F2 descendants (either by using the misshapen head phenotype or the ectopic pseudovulval effects in males occurs post-translationally (Salser et al., 1993). phenotype in a lin-12(n137)/+ background). The animals were then That is, LIN-39 and MAB-5 proteins can somehow inhibit each stained with the MH27 monoclonal antibody (see below) to confirm other’s activity when both proteins are present in the same cell. that they were homozygous for mu220. Animals homozygous for the Moreover, the relative levels of the two proteins do not matter Hox mutations were subsequently identified among the progeny of because the two proteins are still capable of inhibiting each these mu220 homozygotes (using the Egl phenotype for lin-39 and other when one of the Hox genes is strongly overexpressed egl-5 and the QL descendant migration defect for mab-5). All Hox (Salser et al., 1993). This result argues against a model in mutant alleles used are predicted to be null alleles by genetic, DNA which the two Hox proteins simply sequester each other and,as sequence and/or immunofluorescence criteria (Chisholm, 1991; Clark a consequence, titrate each other’s activity. Instead, something et al., 1993; Ferreira et al., 1999; Salser and Kenyon, 1996; Wang et else appears to be limiting in this cell fate decision. One al., 1993), except for mab-5(e1751), which is a gain-of-function allele that results in misexpression of wild-type mab-5 in all Pn.p cells possibility is that both proteins bind to regulatory sites in the (Hedgecock et al., 1987; Salser et al., 1993). same target gene, which in turn encodes a protein that directly affects cell fusion. In this model, the binding of either protein Screen for Pn.p cell fusion mutants alone influences the activity of the fusion gene, whereas the To identify mutations affecting Pn.p cell fusion, lin-12(n137); him- binding of both Hox proteins together does not. 5(e1467) young adults were mutagenized with 50 mM EMS for 4 In summary, Hox protein activity is regulated in two key hours. F2 progeny were picked to individual plates and F3 and F4 ways to control the Pn.p cell fusion decision. First, MAB-5 is progeny were screened for extra pseudovulvae. One of the mutants present in the same cells in both sexes but only functions in isolated was ref-1(mu220), which often generated extra pseudovulvae male Pn.p cells. Thus, something keeps MAB-5 inactive in the in the posterior body region. The ref-1; lin-12animals failed to mate as either males or hermaphrodites, probably because of mating defects hermaphrodite Pn.p cells. Second, both Hox proteins can present in lin-12animals (Greenwald et al., 1983). In order to outcross interact to inhibit each other when present in the same Pn.p cell the ref-1mutant, these animals were further treated with a second dose in males. (12.5 mM) of EMS. Progeny of mutagenized worms occasionally laid To identify genes that affect Pn.p cell fusion by regulating eggs. Animals on plates containing eggs were transferred repeatedly Hox protein activity, we isolated mutations that alter the Pn.p to fresh plates for several generations, at which point worms cell fusion pattern. One such mutation, ref-1(mu220) containing a putative lin-12(n137) suppresser had overrun the (REgulator of Fusion-1) prevents fusion of posterior Pn.p cells population. These animals mated successfully. The lin-12suppresser in hermaphrodites, largely, but not completely, by affecting the identified was tightly linked to lin-12, as the Lin-12 phenotype was sex-specific activity of MAB-5. ref-1 mutants also exhibit a not observed during outcrossing. All characterization of ref-1 defect in the specification of the fate of a hypodermal cell described in this paper, with the exception of the lineages described in Fig. 4, was carried out in a ref-1(mu220) strain that had been located on the lateral surface of the worm in this same posterior outcrossed three times and that was genotypically wild-type for lin- body region as well as other defects in the anterior part of the 12. worm. We have cloned ref-1 and determined that it encodes a transcription factor with two basic helix-loop-helix (bHLH) Characterization of ref-1(mu220)phenotypes domains, both of which are distantly related to the hairy/ Animals were stained with the monoclonal antibody MH27 to Enhancer of split [E(spl)] subfamily of such proteins. determine whether Pn.p cells had fused with hyp7 or remained Regulation of cell fusion in C. elegans 1795 unfused (Francis and Waterston, 1991; Kenyon, 1986). Staged obtain the 3¢ end and the spliced leader sequence SL1 primer to obtain populations of animals were stained in early L2 after the lateral V the 5¢ cDNA end. Only a single isoform was isolated from several cells had divided 2-3 times (about 16 hours for wild-type worms at clones; it exactly matched the Genefinder predicted intron/exon 20°C, somewhat longer for worms carrying several mutations). P12.p structure. A single point mutation was identified in cDNA products behaves differently than the anterior Pn.p cells and thus was not scored derived from ref-1(mu220)DNA (see Results). for cell fusion. To determine if the H1 seam cell was fused, newly hatched animals were stained with MH27. Staining with the LIN-39 antiserum was carried out as described by Maloof and Kenyon RESULTS (Maloof and Kenyon, 1998). Analysis of the V5 and V6 cell lineages, which was performed to observe ectopic V6 postdeirid formation, was Isolation of Pn.p cell fusion mutants carried out from late L1 just prior to the second V cell division to the middle of L2 after postdeirid production appeared to be complete. The lin-12 is a C. elegans homolog of the Drosophila Notch ectopic postdeirid phenotype was only about 10% penetrant in a strain receptor (Yochem et al., 1988). In lin-12(n137) animals, all that was outcrossed three times; however it was somewhat more unfused Pn.p cells undergo several rounds of division and penetrant (30%) in a strain outcrossed only once, suggesting that there generate ectopic pseudovulval-like structures on the ventral may be a modifier of this phenotype in the mutagenized background. surface of the worm (Fig. 2A; Greenwald et al., 1983). lin- Hermaphrodite alae and male ray production were scored in young 12(n137) worms typically have five and never more than six adults. The Fisher Exact Test (determined using Statview Software, such pseudovulvae. These pseudovulvae are generated by the SAS) was used to calculate Pvalues for all experiments. six unfused Pn.p cells P(3-8).p (Greenwald et al., 1983). We Mapping and cloning ref-1 reasoned that mutations that alter the pattern of Pn.p cell fusion would change the pattern of pseudovulvae in a lin-12(n137) Both the Pn.p cell fusion and ectopic V6 postdeirid ref-1phenotypes were found to be recessive; the Pn.p cell fusion defect was assayed in background. To identify mutations that affect Pn.p cell fusion, mapping experiments. ref-1 was first mapped using STS mapping we therefore mutagenized lin-12(n137) worms. Among the (Williams et al., 1992) between two polymorphisms, stp36and map1, descendants of mutagenized worms, we identified animals that and was tightly linked to a third polymorphism, stp98, on the center of LG II. Chromosomal deficiencies were then used to refine the map position. The Pn.p cell fusion defect was generated when ref- A. 12 Pn.p cells 1(mu220) was placed in trans to the deficiencies mnDf66, mnDf57, mnDf83 and mnDf29 but not mnDf59 and mnDF63. Three factor mapping was then used to place ref-1 between unc-4 and bli-1. Transformation rescue of the Pn.p cell fusion phenotype was obtained with pools of cosmids located in this region. Ultimately, rescuing activity of the Pn.p cell fusion phenotype was positioned on a single B. Hermaphrodite cosmid, T01E8. This cosmid also completely rescued the ectopic postdeirid and misshapen head phenotypes. A candidate open reading Pn.p: 1 2 3 4 5 6 7 8 9 10 11 frame for ref-1 identified by the C. elegans sequencing project was MAB-5 T01E8.2, which encodes a putative transcription factor. A 10.9 kb LIN-39 AvrII-NgomIV subclone (pSA139) encompassing this gene plus 7.0 kb upstream and 2.5 kb downstream sequence was injected into ref- 1(mu220) mutants. Injection of the T01E8 cosmid at concentration >10 ng/m l or of this subclone at concentration >3 ng/m l induced strong LIN-39 OFF ON embryonic lethality, suggesting that misexpression and/or overexpression of this gene was toxic. 3/3 lines generated with this 10.9 kb subclone injected at 3 ng/m l gave approximately 50% rescue C. Male of the Pn.p fusion phenotype (n>300 all lines, P<0.0001). Control injection of an otherwise identical DNA construct lacking the coding Pn.p: 1 2 3 4 5 6 7 8 9 10 11 sequence (NcoI deletion-pSA155) injected at 50 ng/m l completely MAB-5 failed to rescue 9/9 lines. One of the lines rescued with the 10.9 kb LIN-39 subclone was tested for rescue of other ref-1(mu220)phenotypes. The misshapen head phenotype was rescued in 89% of the animals (3/232 with array, 54/465 without array, P<0.0001) and the V6 postdeirid LIN-39 OFF OFF ON ON phenotype was rescued in 48% of worm sides (11/232 with array, 39/442 without array, P=0.063). The formation of the wild-type V5 MAB-5 OFF ON OFF ON postdeirid was also prevented at low frequency (7/232 worm sides) in the rescued lines, suggesting that a small amount of misexpression or overexpression of wild-type ref-1was capable of inhibiting postdeirid Fig. 1.The Hox genes lin-39and mab-5regulate the fusion of Pn.p production in V5 as well as V6. cells with the hyp7 syncytium. (A)A schematic view of a late L1 To confirm that ref-1 was T01E8.2, double stranded RNA was larvae with the 12 ventrally located Pn.p cells shown. Some of the generated from a full length cDNA clone (see below) and injected into Pn.p cells fuse with hyp7, which is located more dorsally along most the gonad of wild-type hermaphrodites. Such RNA interference of the mid-body region. Anterior is to the left in this and all figures. (RNAi) (Fire et al., 1998) induced grossly misshapen heads (15% of (B,C) Diagram of Pn.p cell fusion in wild-type hermaphrodite (B) animals, n=98) and ectopic V6 postdeirids (4% of animals, n=116) in and male (C). Unfused cells are depicted by open circles, cells fused progeny of injected parents. with hyp7 by dashes. Hox gene expression domains are similar in To identify the molecular lesion in ref-1(mu220), we isolated and both sexes, as indicated in cross-hatched regions. The two tables sequenced cDNA clones generated by RT-PCR (Frohman, 1993) from show how Hox gene expression information is interpreted in the cell wild-type and ref-1(mu220)DNA. The oligo(dT) primer was used to fusion decision. 1796 S. Alper and C. Kenyon Fig. 2.Posterior Pn.p cells remain unfused inappropriately in ref-1(mu220)mutants. (A,B) Unfused Pn.p cells are inferred from the presence of pseudovulval-like structures (indicated by black arrowheads) on the ventral surface of the worm in a lin-12(n137) background. lin-12(n137) hermaphrodites (A) usually contain five and no more than six pseudovulvae. ref-1(mu220); lin-12(n137)hermaphrodites frequently have extra pseudovulvae in the posterior body region (B). (C,D) Unfused Pn.p cells visualized by immunostaining animals with the MH27 monoclonal antibody. Wild-type worms have six unfused cells [P(3-8).p] (C) while ref-1(mu220)worms often have extra unfused cells in the posterior (P(3- 10).p unfused in this picture; D). had more than six pseudovulvae in a lin-12(n137)background (lf) allele. Thus we infer that the wild-type function of ref-1 (see Materials and Methods). One such mutant, ref-1(mu220), is to allow the posterior Pn.p cells to fuse correctly in frequently had between one and three ectopic pseudovulvae hermaphrodites. In wild-type worms, some Pn.p cells that in the posterior body region (compare Fig. 2A with B). To remain unfused in L2 do fuse with hyp7 later in development determine whether these ectopic pseudovulvae corresponded to (for example, P(3-6).p in males and P3.p in 50% of extra unfused Pn.p cells, ref-1(mu220) worms were stained hermaphrodites). Likewise, in a lin-12(+) background, the with MH27, a monoclonal antibody that labels a component of ‘unfused’ posterior Pn.p cells in ref-1(mu220) remained adherens junctions and thus outlines unfused cells (Francis and unfused through L2 but did subsequently fuse with hyp7 by the Waterston, 1991; Kenyon, 1986). P9.p and P10.p sometimes time the vulval precursor cells divide in L3, as determined by (and P11.p rarely) remained unfused in ref-1(mu220) animals MH27 staining. Thus, ref-1specifically affects Pn.p cell fusion (Fig. 2C,D and Table 1). Anterior Pn.p cells (P1.p and P2.p) early but not later during larval development. and other lateral hypodermal cell fusions in the worm were largely unaffected, suggesting that this mutation affects the MAB-5 is inappropriately active in the Pn.p cells of pattern of Pn.p cell fusion and not cell fusion more generally. ref-1(mu220)hermaphrodites ref-1also did not affect the male Pn.p cell fusion pattern (data Because the pattern of Pn.p cell fusion is regulated by Hox not shown). genes, we tested if alterations in Hox gene expression or Hox The ref-1(mu220) mutation was recessive, suggesting that protein activity were responsible for the Pn.p cell fusion the mutation likely reduces or eliminates gene activity (also see phenotype in ref-1. We first tested whether the Pn.p cell fusion below). Moreover, when mu220 was placed in trans to a defect in the ref-1 mutant was due to misexpression of lin-39 chromosomal deficiency, the mu220 phenotype was not in the posterior of the worm. We stained ref-1mutant animals enhanced, suggesting that mu220 is a strong loss-of function with an antiserum to LIN-39 (Maloof and Kenyon, 1998) and Table 1. Posterior Pn.p cells remain unfused in ref-1(mu220)hermaphrodites Unfused Pn.p cells (%) Strain 1 2 3 4 5 6 7 8 9 10 11 n Wild type 0 0 100 100 100 100 100 100 0 0 0 111 ref-1(mu220) 0 0 100 100 100 100 100 100 26 26 2 773 lin-39(n1760) 0 0 0 0 0 0 0 0 0 0 0 102 ref-1(mu220); lin-39(n1760) 0 0 0 0 0 2 28 31 28 19 10 304 C. elegansearly L2 larvae were stained with the MH27 antibody to score Pn.p cell fusion. Indicated are the percentage of Pn.p cells that remain unfused in the listed mutants. The number of animals scored is listed on the right. Regulation of cell fusion in C. elegans 1797 Table 2.ref-1and mab-5function together to inhibit expression of lin-39in the posterior body region Number of neurons expressing lin-39 posterior to P8.p in the ventral cord Strength of lin-39expression Strain Average Range in posterior nuclei Wild type 3.0 2-5 +/- ref-1(mu220) 3.1 2-5 +/- mab-5(e2088) 6.6 4-9 + ref-1(mu220); mab-5(e2088) 9.6 5-14 +++ C. elegansearly L2 larvae were stained with an antiserum to LIN-39 to examine lin-39expression in the indicated strains. +/- indicates expression that was barely detectable, +indicates stronger expression, and +++ indicates very strong expression similar to wild-type lin-39expression observed in neurons in the mid- body region. Weak lin-39expression was detected at low frequency in P9.p or P10.p in ref-1; mab-5double mutant worms but never in the other three listed strains (as described in Results). n>50 for all strains. found little or no detectable difference in lin-39 expression between wild-type and ref-1(mu220) animals (Table 2). To confirm that misregulation of lin-39was not responsible for the ref-1 Pn.p cell fusion defect, we constructed the ref-1; lin-39 double mutant. Normally, all Pn.p cells fuse with hyp7 in a lin- 39mutant (Table 1). If inappropriate expression of lin-39were responsible for the extra unfused cells in the ref-1mutant, then removal of lin-39 should suppress the ref-1 Pn.p cell fusion defect. However, in the ref-1; lin-39 double mutant, not only did P(9-11).p often remain unfused but P7.p and P8.p did as well (Table 1), revealing a ref-1 mutant phenotype that was masked when the wild-type lin-39 gene copy was present. Thus, P(7-11).p could all remain unfused inappropriately in ref-1(mu220) mutants in a lin-39-independent fashion (although lin-39can play a role under other special conditions: see below). Interestingly, this region corresponds to the domain of mab-5 expression (Salser et al., 1993; Wang et al., 1993), raising the possibility that MAB-5, which is normally inactive in hermaphrodite Pn.p cells, might be inappropriately preventing Pn.p cell fusion in the ref-1(mu220) hermaphrodites. To investigate whether MAB-5 might be active in Pn.p cells of ref-1hermaphrodites, we used the gain-of-function mutation mab-5(e1751) to misexpress mab-5 in all Pn.p cells. In particular, P1.p and P2.p, cells which do not normally express lin-39, mab-5, or egl-5, do express mab-5 in a mab-5(e1751) background (Salser et al., 1993). In otherwise wild-type animals, mab-5(e1751)hermaphrodites still exhibit a wild-type Pn.p cell fusion pattern because MAB-5 is inactive in wild- type hermaphrodites (Table 3). However, in the ref-1; mab- 5(e1751) strain, P1.p and P2.p often remained unfused (Table 3). This indicated that, in ref-1 mutants, MAB-5 can function inappropriately in hermaphrodite Pn.p cells. To confirm that MAB-5 was affecting cell fusion in the ref-1 mutant, we examined the Pn.p cell fusion phenotype of ref-1; mab-5(lf) double mutants (Table 3). In mab-5(lf)single mutants, P9.p and P10.p still fused with hyp7, as in wild type (Table 3). P11.p, however, is sometimes transformed into a copy of its posterior neighbor, P12.p (Kenyon, 1986). Thus, P11.p sometimes remained unfused (as determined by MH27 staining) in a mab- 5(lf) mutant (Table 3). In the ref-1; mab-5(lf) double mutant, the severity of the ref-1P9.p and P10.p cell fusion defect was strongly reduced (by 60%, P<0.0001). Thus, inappropriate Fig. 3.ref-1(mu220)worms sometimes have misshapen heads. activation of MAB-5 was at least partially responsible for the Nomarski micrographs of wild-type (A) and ref-1(mu220)(B- Pn.p cell fusion defect in ref-1 worms. However, P9.p and D)heads. Gross defects such as these occur approximately 10% of P10.p still sometimes remained unfused in this double mutant, the time; much less severe defects are more common. 1798 S. Alper and C. Kenyon posterior body region, thereby also allowing posterior Pn.p H0 H1 H2 cells to fuse. V1 V6 T V2 V5 V3 V4 egl-5can also affect Pn.p cell fusion in ref-1mutant animals Wild type ref-1(mu220) V5 V6 V6 V6 V6 A few Pn.p cells still remain unfused in the ref-1; lin-39 mab- 5 triple mutant. To test if other Hox genes besides lin-39 or mab-5might influence Pn.p cell fusion, we examined the effect of an egl-5mutation in a ref-1background. egl-5is expressed in P12.p and causes it to adopt a fate distinct from the other H H Pn.p cells (Chisholm, 1991). However, in an otherwise wild- PD PD type background, egl-5does not affect the other 11 Pn.p cells. 4 worms 1 worm 1 worm The introduction of an egl-5mutation into ref-1animals caused 14 wild type worms a 35% decrease in the P9.p and P10.p cell fusion defect (P=0.001) (Table 4) suggesting that egl-5 is also partially Fig. 4.The V6 seam cell sometimes generates an ectopic postdeirid. responsible for keeping posterior Pn.p cells unfused in the ref- At the top is a schematic view of a worm displaying the 10 seam 1 mutant. Consistent with this possibility, the Pn.p cell fusion cells in a newly hatched animal. Shown below are partial lineages of defect in the ref-1;mab-5 egl-5 triple mutant was substantially wild-type and ref-1(mu220)worms. Lineages were carried out as described in Materials and Methods. PD indicates the cluster of weaker than in ref-1; mab-5 or ref-1; egl-5 animals alone neurons that make up the wild-type postdeirid; H, hypodermal cell; (Table 4) (P<0.0001). However, a small percentage of posterior filled circles, neuronal cells; x, cell death. These lineages were Pn.p cells still remained unfused in this triple mutant. egl-5is carried out in an isolate of mu220that was only outcrossed once not normally expressed in the cells affected by ref-1 (Ferreira because the postdeirid phenotype was more penetrant in this strain et al., 1999), and we found no detectable change in egl-5 (see Materials and Methods). expression in ref-1mutant animals using an egl-5::lacZfusion. Perhaps a low level of egl-5that is undetectable by this reporter indicating that ref-1 also played another role in the regulation construct is misexpressed in ref-1 mutant animals. egl-5 is of Pn.p cell fusion. Fig. 5.ref-1encodes a protein with two basic helix-loop-helix DNA REF-1 and MAB-5 function redundantly to inhibit lin- binding domains most similar to the hairy/E(spl)family of bHLH 39expression in the posterior body region proteins. (A) Sequence and inferred translation of ref-1cDNA Although the addition of a lin-39 mutation to ref-1 mutant determined by sequencing of RT-PCR products. The mRNA is trans- animals did not suppress the ref-1Pn.p cell fusion defect (see spliced to the SL1 leader sequence (double underline). Both bHLH above), the Pn.p cell fusion defect in ref-1; lin-39 mab-5triple domains are indicated by a single underline. Location of introns is mutant animals was substantially weaker than in ref-1; lin-39 indicated by black triangles. The COOH-terminal FRPWE motif, which is similar to the WRPW motif in hairyfamily members, is or ref-1; mab-5 double mutant animals (P<0.0001) (Table 4). boxed. A putative polyadenylation signal is triple underlined. Why does lin-39 appear to play a role in the ref-1 Pn.p cell Mutation in the mu220allele is indicated. (B)Alignment of both fusion defect when a mab-5 mutation is present in the strain bHLH domains of REF-1 with related bHLH domains. The first two but not when it is absent? To resolve this question, we rows are the two REF-1 bHLH domains, followed by the bHLH examined the lin-39expression pattern in ref-1; mab-5double domains of eight hairy/E(spl)family members. The other genes are mutant animals using a LIN-39 antiserum. In addition to the rat Hes1(Sasai et al., 1992), Xenopushairy1(Dawson et al., 1995), Pn.p cells, many neurons lie along the ventral surface of the Drosophila hairy(Rushlow et al., 1989), C. eleganslin-22 worm. lin-39 is expressed at high levels in P(3-8).p and in all (Wrischnik and Kenyon, 1997), Xenopusesr-5(Jen et al., 1999), ventrally located neurons that lie in that body region. Only mouse Hes5(Takebayashi et al., 1995) and DrosophilaEnhancer of relatively weak lin-39 expression is found in a few neurons split transcripts m3and mb (Delidakis and Artavanis-Tsakonas, 1992; Knust et al., 1992). Residues identical or similar in at least posterior to P8.p in the ventral cord in either wild-type, ref-1, 50% of sequences are highlighted in black and gray, respectively. or mab-5 mutant animals (Table 2) and lin-39 is never The conserved arginine that is altered in the first bHLH domain in expressed in the posterior Pn.p cells in these three strains. In the mu220allele is marked by two stars. The proline that is usually contrast, more neurons express lin-39 at substantially higher conserved in hairyfamily members is indicated with a vertical line. levels in the posterior ventral cord in the ref-1; mab-5 double Data analysis was carried out using GCG Wisconsin Package version mutant (Table 2), indicating that the two genes function 10.1, Genetics Computer Group, Madison, Wisc. Alignments were redundantly to inhibit posterior lin-39 expression. Moreover, carried out using GCG Pileup. Highlighting of identical and similar at low frequency (approximately 4% of animals), weak levels residues was done by Boxshade. The % identities between the of lin-39 were detected in P9.p or P10.p in the ref-1; mab-5 various bHLH domains and the two REF-1 bHLH domains are double mutant animals. The ref-1; lin-39 mab-5 Pn.p cell indicated to the right. Pairwise comparisons to calculate % identity of bHLH regions were carried out using GCG GAP. (C)Schematic fusion data suggest that lin-39is affecting more than 4% of the alignments of REF-1 and five other proteins predicted in the C. animals; a low level of lin-39 undetectable by our antiserum elegansgenome that contain two putative bHLH domains. % identity may be responsible for this (undetectable levels of lin-39 are to REF-1 bHLH #1 indicated in light gray region and to REF-1 sufficient to prevent Pn.p cell fusion in egl-27mutant animals; bHLH #2 indicated in dark gray region. These bHLH domains were Ch’ng and Kenyon, 1999). Thus, in addition to its primary role identified using psiblast (Altschul et al., 1997), profilescan (ISREC, of preventing MAB-5 from affecting Pn.p cell fusion, ref-1also Swiss Institute for Experimental Cancer Research implementation), functions with mab-5 to prevent lin-39 expression in the and manually. Regulation of cell fusion in C. elegans 1799 A GGT TTA ATT ACC CAA GTT TGA GAA ATG GTC CTC ATC AGT ACC CCA CCA CCA GCT TAC GCT 60 M V L I S T P P P A Y A G95A = R-->Q | CAT AAC AGA AAA ACA TCA CAG GAG AAG AAA CGA CGA GAT GAG ATT AAT GCA AAG ATC AAG 120 H N R K T S Q E K K R R D E I N A K I K GAG CTT CAA CTA TTG ATT CAA AAT GAA TCG GAT AAT GAG AAA ATG ACC CAA GGT GAT GTC 180 E L Q L L I Q N E S D N E K M T Q G D V TTA AAC CGT GCA GTC GAA GTG GTC AGT CGC ATG GAA ACC GAA TCA CCT GGA CCA TCA TCA 240 L N R A V E V V S R M E T E S P G P S S AAT CCA AAT CGC AAA GGA TTC TTT GAC GGA TTC CGA TCA ATC GAG TCG CTC ACT TAT TCC 300 N P N R K G F F D G F R S I E S L T Y S TTC ATC AAA TCC CTG GGC GTC AAT TCA GAT GTC TGT CAG GAT TTT GTG CAA CGT GCC AAG 360 F I K S L G V N S D V C Q D F V Q R A K CAG TTT TTC GAT CGA GAA CGT TCA TCT TTG CTG AGC ACT GTA TCT GGA AAA TCA AAG AGA 420 Q F F D R E R S S L L S T V S G K S K R AGA TCT GAG TCG GAA ATT CTC CAC Tct TCA ATG AGC TAT AGA TCC CAG TCA AGC TCT CCA 480 R S E S E I L H S S M S Y R S Q S S S P TCG ACA TCG GAA TCT GGA ATC ACA ATT GAT AGA AAG GAA GTG AAA AAG AAT AGA GAG CAA 540 S T S E S G I T I D R K E V K K N R E Q GAT AGA AGA GAT CGT CAG GGA GAA GCT TTT GAT GCT TTG AAG AAC TTT ATC ATT GAG AAC 600 D R R D R Q G E A F D A L K N F I I E N AAG CTC ATG ACA TCT CAT CAA GTC GAA AAA ATG CAA CGC TTG AAC ACC CTG GAT ATC ATA 660 K L M T S H Q V E K M Q R L N T L D I I ATT GCC TAC ATT CAA AAC AAG AAG CAC AAT TTT GTT AGT CGA AGC GAC CAG GAG CAG TCA 720 I A Y I Q N K K H N F V S R S D Q E Q S CTC TAT GCA CAT GCA ATT GCA GAG GGA AAG AAG ACT GCA AAA AAC ATT GCC TTC CAA TTT 780 L Y A H A I A E G K K T A K N I A F Q F TTC AAG AGC GAC CGT CAC CTC GTT GTC CGA TGC GCA GAC CTT GAA AAG TTC TTC GAA TTC 840 F K S D R H L V V R C A D L E K F F E F TCC TTA TCA CCA AAG CCA CTC TTT GGA TTC CCA TCC ATG CCC ATC CCA ATT CCA CCA CCA 900 S L S P K P L F G F P S M P I P I P P P TCA TTC CCA ATC TTC CCA TTC CGG CCA TTC CCA TTC TTC CCA ATG CCA ATG GCA CCA ATG 960 S F P I F P F R P F P F F P M P M A P M GCA ACA AGT CCA AAA TCT CAA CAG TCT CCA TCA TAT TCA CTG GAT TCT CCA CCA CCA TCA 1020 A T S P K S Q Q S P S Y S L D S P P P S TCC GAT ACT TCT TCG TCA TCA ATC GAA ACA CCA TCC ACT CCA AAT GAG AAC TCG AAT TCC 1080 S D T S S S S I E T P S T P N E N S N S AAT CCT AAA GCT TCA AGA AAG AGT AAG CTG TTC AGA CCA TGG GAA TAA CTT TTC TAA AAA 1140 N P K A S R K S K L F R P W E * ATA TAT CTC CTT TAA TTG TAA TTT AGT GTT AAA AGT ATA TAT TCT TAT TAA TAA TTT ATC 1200 ATC CTC AAA ATG TTA TCG ACT TTT TCA ACT TAT CAT ATC ATT ATC ATC TCA CAA CCA AAA 1260 TCT AGT TTT ATT GTC ACG GGC TAT TAA ACT TAC CGG TAG GTT TTA TAA ATC CTT AAT TGT 1320 TGT TTT CCC TCA GTA TTC ATA ATA TTT ATA TTG AAT TTT CCG ATT TTC AGT GAT TTT GAA 1380 GAT TAA ATG ACT GCA GAA TAA AGT ATT TAT TAT CTC T poly A+ % Identity to B BASIC HELIX 1 LOOP HELIX 2 re#f1-1 bH#L2H: ref-1 bHLH #1 YAHNRKTSQEKKRRDEINAKIKELQLLI.....QNESDNEKMTQGDVLNRAVEVVSRME - - ref-1 bHLH #2 DRKEVKKNREQDRRDRQGEAFDALKNFIIENKLMTSHQVEKMQRLNTLDIIIAYIQNKK 22 - rat Hes1 HRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQ 33 25 Xenopus hairy1 HRKSSKPIMEKRRRARINESLGQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQ 33 25 hairy DRRSNKPIMEKRRRARINNCLNELKTLILDATKKDPARHSKLEKADILEKTVKHLQELQ 28 22 lin-22 KKIKNKPLMEKKRRARINKSLSQLKQILIQDEHKNSIQHSKWEKADILEMAVEYLQQLR 39 26 esr-5 SRKILKPVVEKQRRDRINRSLGEMRILLFQLTGNQKLQNPKMEKAEILELAVIYIRNVT 39 25 mouse Hes5 KNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQ.PNSKLEKADILEMAVSYLKHSK 37 29 E(spl) m3 YRKVMKPLLERKRRARINKCLDDLKDLMVECLQQEGEHVTRLEKADILELTVDHMRKLK 28 24 E(spl) mb YRKVMKPMLERKRRARINKCLDELKDIMVECLTQEGEHITRLEKADILELTVEHMKKLR 30 20 * * C REF-1 bHLH #1 bHLH #2 F31A3.2 44 36 F31A3.4 44 36 C17C3.8 32 37 C17C3.7 34 38 C17C3.10 34 38 1800 S. Alper and C. Kenyon misexpressed more anteriorly in mab-5mutant worms (Ferreira et al., 1999). However, any egl-5that is misexpressed in a mab- H0 H1 H2 V1 V2 V3 V4 V5 V6 T 5background does not affect P9.p and P10.p cell fusion in ref- 1 2 3 4 5 6 7 8 9 10 11 12 1(+) worms (Table 4). This suggests that ref-1 might affect EGL-5 activity as well as egl-5expression. lin-22: anterior defects ref-1: posterior defects The Pn.p cell fusion pattern in animals lacking all three of Male Pn.p fusion defect Hermaphrodite Pn.p fusion these Hox genes, lin-39, mab-5and egl-5, was very similar to in P(3-8).p defect in P9.p and P10.p that of the ref-1; lin-39 mab-5 egl-5 quadruple mutant Ectopic postdeirids in Ectopic postdeirid in V6 (P>0.99). Surprisingly, there are still unfused Pn.p cells in the V1-V4 Hox triple mutant. While it is unclear why some Pn.p cells H1 cell fate defect remain unfused in this background (it could be due to an Misshapen head defect uncharacterized interaction between the three Hox genes or due to the severe sickness of the strain), the Pn.p cell fusion defect Fig. 6.Mutation of two C. eleganshairyhomologs, ref-1and lin-22, was similar whether or not the ref-1 mutation was present, causes similar phenotypes in different body regions. At top is a schematic view of a worm (anterior to left) with seam cells indicated suggesting that the ref-1 Pn.p cell fusion defect might be due on the lateral surface and Pn.p cells indicated on the ventral surface. entirely to alterations in the activity of these three Hox ref-1(mu220)phenotypes in black, lin-22phenotypes in gray. ref-1 proteins. mutants have Pn.p cell fusion defects in the posterior region of hermaphrodites while lin-22mutants have Pn.p cell fusion defects The ref-1mutant also has other defects in distinct more anteriorly in males. Similarly, ref-1mutants sometimes AP body regions generate an ectopic postdeirid derived from V6 in the posterior while ref-1 mutants also exhibit other defects that, unlike the Pn.p lin-22mutants form ectopic postdeirids more anteriorly. Finally, ref- cell fusion defect, occur in both sexes. ref-1(mu220) larvae 1mutants, but not lin-22mutants, have head defects that include occasionally have misshapen heads. These head defects vary fusion of the H1 seam cell and misshapen heads. considerably, ranging from small notches or lumps in the side of the worm head to strongly bent heads (Fig. 3). Animals with severely bent heads move in an uncoordinated fashion. Gross adults. Seam cells in adult hermaphrodites secrete a cuticular defects such as those depicted in Fig. 3 occur in approximately structure known as alae; small gaps were sometimes seen in 10% of ref-1mutant animals although much more subtle head the alae in the V6 body region in ref-1mutants, consistent with shape defects are more common. a loss of part of the wild-type V6 cell lineage. In males, the In a newly hatched worm, ten seam cells are located along V5, V6, and T seams cells on each side of the animal generate both lateral surfaces of the worm (from anterior to posterior: 9 copulatory structures called rays. ref-1mutants occasionally H0, H1, H2, V1-V6, T – Fig. 4, top). To further study the lack two V-cell-derived rays. This phenotype is expected in structure of the ref-1 mutant head, we stained newly hatched animals in which cells in one branch of the V6 lineage ref-1mutant animals with the MH27 antiserum and found that generated a postdeirid instead of adopting their normal fate the H1 seam cell occasionally fused inappropriately with either (generating cells that produce rays). hyp7 or another head syncytial cell (data not shown). This defect may not be responsible for the misshapen head ref-1encodes a protein with two bHLH domains that phenotype since some animals in which all seam cells were are distantly related to the hairy/E(spl)family unfused still had misshapen heads. ref-1(mu220) was mapped to a 1.3 map unit region between Although posterior seam cells did not display any defects in unc-4and bli-1on the center of chromosome II and cloned by newly hatched ref-1(mu220)mutants, a defect was present later transformation rescue (see Materials and Methods). The in development in the posteriorly located V6 cell. Normally V5 cosmid T01E8 and subclones of this cosmid containing the is the only seam cell that generates a neuronal structure called predicted open reading frame T01E8.2 rescued the Pn.p cell a postdeirid (Fig. 4). At low frequency in ref-1(mu220)worms, fusion, misshapen head, and ectopic postdeirid defects of ref- V6 also generates a postdeirid-like structure (Fig. 4) indicating 1(mu220) worms. This open reading frame encodes a protein a partial transformation of V6 to V5. This lineage with two putative basic helix-loop-helix (bHLH) domains, transformation of V6 to a V5-like fate is probably responsible suggesting that REF-1 protein functions as a transcription for later defects observed in the posterior body region of ref-1 factor. RT-PCR products from wild-type and mu220 animals Table 3. MAB-5 prevents Pn.p cell fusion in ref-1(mu220)hermaphrodites Unfused Pn.p cells (%) Strain 1 2 3 4 5 6 7 8 9 10 11 n Wild type 0 0 100 100 100 100 100 100 0 0 0 111 ref-1(mu220) 0 0 100 100 100 100 100 100 26 26 2 773 mab-5(e1751) 0 0 100 100 100 100 100 100 0 0 0 100 ref-1(mu220); mab-5(e1751) 35 26 100 100 100 100 100 100 19 16 5 385 mab-5(e2088) 0 0 100 100 100 100 100 100 0 0 15 191 ref-1(mu220); mab-5(e2088) 0 0 100 100 100 100 100 100 12 9 8 832 C. elegansearly L2 larvae were stained with the MH27 antibody to score Pn.p cell fusion. Indicated are the percentage of Pn.p cells that remain unfused in the listed mutants. The number of worms scored is listed on the right. The wild-type and ref-1(mu220)data presented in this table are also presented in Table 1. Regulation of cell fusion in C. elegans 1801 Table 4. lin-39, mab-5and egl-5affect Pn.p cell fusion in ref-1(mu220) Unfused Pn.p cells (%) Strain 1 2 3 4 5 6 7 8 9 10 11 n Wild type 0 0 100 100 100 100 100 100 0 0 0 111 ref-1(mu220) 0 0 100 100 100 100 100 100 26 26 2 773 lin-39(n1760) 0 0 0 0 0 0 0 0 0 0 0 102 ref-1(mu220); lin-39(n1760) 0 0 0 0 0 2 28 31 28 19 10 304 mab-5(e2088) 0 0 100 100 100 100 100 100 0 0 15 191 ref-1(mu220); mab-5(e2088) 0 0 100 100 100 100 100 100 12 9 8 832 egl-5(u202) 0 0 100 100 100 100 100 100 0 0 0 127 ref-1(mu220); egl-5(u202) 0 0 100 100 100 100 100 100 17 17 4 328 lin-39(n1760) mab-5(e1239) 0 0 0 0 0 0 0 0 0 0 16 86 ref-1(mu220); lin-39(n1760) mab-5(e1239) 0 0 0 0 0 0 1 1 1 3 18 337 mab-5(e1239) egl-5(n945) 0 0 100 100 100 100 99 100 0 0 6 106 ref-1(mu220); mab-5(e1239) egl-5(n945) 0 0 100 100 100 100 100 100 5 5 4 643 lin-39(n1760) mab-5(e1239) egl-5(n945) 0 0 0 0 0 0 0 1 9 4 4 186 ref-1; lin-39(n1760)mab-5(e1239)egl-5(n945) 0 0 0 0 0 0 0 1 10 7 9 94 C. elegansearly L2 larvae were stained with the MH27 antibody to score Pn.p cell fusion. Indicated are the percentage of Pn.p cells that remain unfused in the listed mutants. The number of worms scored is listed on the right. Some of the data in this Table are also presented in Tables 1 and 3. All Hox mutant alleles used are likely to be null, as described in Materials and Methods. were generated and sequenced (see Materials and Methods) to elegansHox gene cluster, lin-39and mab-5(Clark et al., 1993; verify the predicted intron/exon structure for this gene and to Wang et al., 1993). The pattern of Pn.p cell fusion is more identify the molecular lesion in the mu220 allele, a Gfi A complex than the simple expression patterns of these Hox transition that alters a conserved arginine in the first basic genes would allow because Hox protein activity is regulated in region (Fig. 5A,B). To verify that this open reading frame was a sexually dimorphic manner (Salser et al., 1993). This is ref-1, RNA interference (Fire et al., 1998) was carried out with presumably accomplished by the interaction of these two Hox double stranded RNA generated from a full length ref-1cDNA proteins with each other and also with other factors. In this clone. Injection of ref-1dsRNA into wild-type hermaphrodites work, we have identified one such factor, REF-1, that is caused the formation of misshapen heads as well as ectopic V6 required for proper regulation of posterior Pn.p cell fusion in postdeirids in the progeny of injected animals (see Materials hermaphrodites. and Methods). Both ref-1 bHLH domains are distant members of the REF-1 alters Hox protein activity in hermaphrodites hairy/E(spl) subfamily of such bHLH domains (Fig. 5B; a One of the ways that AP diversity is generated in C. elegans phylogenetic tree containing the first bHLH domain can be Pn.p cells is by altering Hox protein activity in a sex-specific found in the on-line supplementary material from Ruvkun and manner. MAB-5 normally only affects Pn.p cell fusion in Hobert, 1998). Both ref-1 bHLH domains lack a conserved males. In principle, this regulation could be accomplished by proline that is normally found in the basic region of these the direct interaction of genes in the sex determination pathway family members (Fig. 5B; Wainwright and Ish-Horowicz, with MAB-5. For example, the zinc finger protein TRA-1, a 1992). ref-1also lacks an obvious orange domain that provides downstream effector in the sex determination pathway (Hunter specificity in some hairy/E(spl) family members (Dawson et and Wood, 1990; Zarkower and Hodgkin, 1992), could bind al., 1995). ref-1 does contain a FRPWE motif at its COOH directly to a cell fusion promoter and in doing so prevent terminus (Fig. 5A), which may be a variant of the COOH- MAB-5 from binding and affecting transcription in terminal WRPW motif found at the end of nearly all hairy hermaphrodites. Alternatively, other unidentified factors could family members (Fisher et al., 1996; Paroush et al., 1994; act either alone or with TRA-1 to modulate Hox protein Wainwright and Ish-Horowicz, 1992). function. This second model appears to be correct because The presence of two bHLH domains in ref-1is unusual and REF-1 is such a factor. REF-1 affects sex-specific Hox protein we have been unable to identify proteins with this structure in activity in the Pn.p cells, but the ref-1 mutant has no other other organisms. However, we have identified a small family obvious sexual transformations. ref-1 may act either of such proteins (Fig. 5C and Ruvkun and Hobert, 1998) in C. downstream or in parallel to the sex determination pathway to elegans. All these bHLH domains are distant members of the affect MAB-5 activity. hairy/E(spl) family that lack the conserved proline. None of ref-1 interacts with mab-5 in two different ways to ensure these predicted proteins other than REF-1 contains a good that posterior Pn.p cells fuse properly. First, ref-1 acts WRPW-like motif at their putative COOH terminus. The negatively on MAB-5 to ensure that MAB-5 does not affect functions of these other genes have not been determined. hermaphrodite Pn.p cell fusion. Second, ref-1 acts positively and redundantly with mab-5 to prevent lin-39 expression in posterior Pn.p cells, which also results in the proper fusion of DISCUSSION these cells. In addition to its interactions with mab-5, ref-1can also influence the ability of EGL-5 to regulate Pn.p cell fusion. To understand how the hyp7 syncytium is generated, we have It is interesting to note that the male Pn.p cell fusion pattern been studying the regulation of the fusion decision of the Pn.p is not altered in the ref-1 mutant. Since wild-type REF-1 cells. Pn.p cell fusion is controlled by two genes of the C. normally affects MAB-5 activity, this suggests that ref-1either 1802 S. Alper and C. Kenyon is not expressed or is inactive in males. The fact that in males, a dimerization region and the basic region contacting DNA LIN-39 and MAB-5 inhibit each other when expressed in the (Littlewood and Evan, 1998). Such dimers could be same cell raises a paradox: why doesn’t this mutual antagonism homodimers or heterodimers between different bHLH proteins. occur in ref-1 hermaphrodites where MAB-5 is now active? Some proteins lacking the basic domain act as repressors by If the two proteins did inhibit one another in ref-1 sequestering partner bHLH proteins in a complex that does hermaphrodites, then P7.p and P8.p would fuse occasionally. not bind DNA (Littlewood and Evan, 1998). hairy family However, in ref-1mutants, those cells always remain unfused. members, in contrast, are often active repressors that recruit One possibility is that still another factor is required for the Groucho to inhibit transcription (Fisher et al., 1996; Paroush interaction between LIN-39 and MAB-5 and that factor also et al., 1994; Van Doren et al., 1994). Since the mu220 allele acts in a sex-specific manner. affects a conserved residue in the first basic region, it is likely that ref-1 functions by binding DNA and that at least the first ref-1and egl-27have overlapping functions in the bHLH domain is required for this interaction. The second Pn.p cells bHLH domain, if functional, could interact with the first bHLH REF-1 is required for complete inhibition of MAB-5 activity domain to regulate it or could interact with other bHLH in hermaphrodites. However, not all Pn.p cells in the posterior proteins. The other C. elegansgenes that encode proteins with remain unfused in ref-1(mu220)animals, raising the possibility two bHLH domains are candidate genes for this interaction. that other factors may also be required for this inhibition (one caveat is that the mu220allele is a missense mutation that may The phenotypes of ref-1are similar to the not be completely null). One such other factor is egl-27, which phenotypes of lin-22and other hairy/E(spl)genes encodes a component of a chromatin remodeling complex The molecular identity of ref-1is intriguing in light of the other (Ch’ng and Kenyon, 1999; Herman et al., 1998; Solari et al., ref-1 mutant phenotypes. In Drosophila, hairy acts as both a 1999). egl-27regulates Pn.p cell fusion in both sexes in several primary pair rule gene that specifies the fate of alternate ways, including regulation of MAB-5 activity and regulation segments and also as a regulator of neuron formation later in of the expression of lin-39, mab-5 and egl-5. In particular, development (Ingham et al., 1985; Moscoso del Prado and posterior Pn.p cells remain unfused in egl-27 mutant Garcia-Bellido, 1984). Two C. elegans hairy homologs, ref-1 hermaphrodites in part due to inappropriate activation of and lin-22, also affect cell fate and neuron formation; MAB-5. egl-27 is also required for the ability of LIN-39 and moreover, they both do so in distinct AP body regions (Fig. 6). MAB-5 to inhibit each other in males. Thus it is possible that For example, ref-1 mutants have a hermaphrodite Pn.p cell egl-27 and ref-1 act in either the same or parallel pathways to fusion defect in the posterior Pn.p cells (although ref-1 can control different aspects of the Pn.p cell fusion decision. influence Pn.p cell fate in more anterior Pn.p cells as revealed in a lin-39 or mab-5(e1751) background). In contrast, lin-22 ref-1encodes an unusual bHLH protein with some mutants have a male-specific Pn.p cell fusion defect in more similarity to the Hairy/E(spl)family anterior Pn.p cells. In lin-22 mutants, P7.p and P8.p remain ref-1 encodes a protein with an unusual structure in that it unfused during the first larval stage (data not shown). contains two predicted bHLH domains. A family of such In addition, P(3-8).p all continue to remain unfused predicted proteins is present in the C. elegans genome. inappropriately and divide later in development (Fixsen, 1985). Interestingly, the first and second bHLH domains within a Like flies carrying a mutation in hairy, ref-1and lin-22mutants given protein tend to be less similar to each other than to the also generate ectopic neuroblasts. Specifically, ectopic corresponding bHLH domain in other family members. This postdeirids are generated by the posterior V6 lateral seam cell suggests that this family may have arisen from the duplication in ref-1 mutants and by the anterior V1-V4 seam cells in lin- of a single gene in which the bHLH domain had already been 22mutants (Fixsen, 1985; Waring et al., 1992; Wrischnik and duplicated. These bHLH domains are most similar to those of Kenyon, 1997). These phenotypes are consistent with a partial the hairy/E(spl) family bHLH domains, although they are (in the case of ref-1) or complete (in the case of lin-22) substantially diverged. The bHLH domains in ref-1 are only transformation of the respective V cells into a V5-like cell fate. about 30% identical to the bHLH domains of other hairy No other single mutation can cause the transformation of V6 family members; in contrast, the bHLH domain of lin-22, to a V5-like fate, although the double mutant combination of another C. elegans hairy homolog, is 60% identical to other lin-22 and pal-1 (a caudal homeobox transcription factor family members. ref-1contains a FRPWE domain at its COOH homolog) does so (Waring and Kenyon, 1991; Waring et al., terminus, a variant of the conserved WRPW domain found at 1992). We observed no synergy between lin-22and ref-1. ref- the COOH terminus of hairy family members (Fisher et al., 1; lin-22 double mutant worms had phenotypes that were 1996; Paroush et al., 1994). This domain is used by hairy to simply the summation of the phenotypes of the individual recruit the corepressor protein Groucho (Fisher et al., 1996; mutants (data not shown). This observation is consistent with Paroush et al., 1994) The C. elegans groucho homolog, unc- the hypothesis that while ref-1 and lin-22 have similar 37, is also a corepressor in other cell fate decisions (Pflugrad functions, they act in distinct AP body regions. et al., 1997), although unc-37(e262) does not affect ref-1mutants have defects not found in lin-22in still another hermaphrodite Pn.p cell fusion (data not shown). While this is AP body region, the head (Fig. 6). ref-1 mutants exhibit a not a null allele of unc-37(null alleles are lethal), it raises the misshapen head defect and also have defects in the possibility that the FRPWE motif in REF-1 may no longer specification of the proper fate of the anterior H1 seam cell. function in recruiting groucho. While hairyacts as a pair rule gene affecting the fate of every Why does ref-1contain two bHLH domains? bHLH proteins other segment in Drosophila (Ingham et al., 1985), in some typically function as dimers with the HLH domains acting as sense, these two C. eleganshairyhomologs are behaving more

