Logout succeed
Logout succeed. See you again!

The Carbohydrates of the Jerusalem Artichoke and other Compositae PDF
Preview The Carbohydrates of the Jerusalem Artichoke and other Compositae
114 I95I The Carbohydrates of the Jerusalem Artichoke and other Compositae By J. S. D. BACON AND J. EDELMAN DepartmentofBiochemistry, UniversityofSheffield (Received 5June 1950) The most fully investigated polysaccharide of the Estimationoftotalreducingsubstances(TRS).Themethod Compositae is inulin (named from Inula helenium), usedwasessentiallythatofMiller& VanSlyke(1936) with firstobtainedfromthetubersoftheJerusalemarti- slight modifications (cf. Bacon & Bell, 1948). Reducing choke, Helianthu8 tuberou,s L. (Rose, 1804), but sugarin easilyhydrolysed combination wasdetermined by more easily prepared from the dahlia tuber (cf. TbyRSadedsitnigma0ti1onvsolb.eoffor5e-5a%nd(awft/evr)hoyxdarloilcysaicsi,dwshoilcuthiwoanstodotnhee McDonald, 1946). ('Artichoke' is used to indicate sampleandheatingthemixturefor30min.inaboiling-water Jloenrgusbaeleenmeavritdiecnhtok(ecft.hTraonurgehto,ut18t9h3ias,pab)petrh.a)tIitnuhlaisn abadtihl.uTtihoencoofnc2e0nttriamteisoonrofmocrarebwohaysdrnaeteedewdasbesfoorcehotsheenTthRaSt may constitute only a small fraction of the total estimation;undertheseconditionsneutralizationoftheacid carbohydrate present in the artichoke tuber, the wasunnecessary. Contrarytothepreviousexperienceofone remainder resembling inulin in being composed ofus (J.S.D. B.; see Bacon & Bell, 1948) we found that essentially of fructofuranose units, but having a fructose gave 1-06 times the reduction by an equivalent greater solubility in water and in aqueous ethanol. amountofglucose.Thecorrectionrequiredwasusuallyabout Theterm'inulide'hasbeenusedbyFrenchworkers the same as the experimental error because the ratio of fructosetoglucoseinthewholeextractswasapproximately (Wolff& Geslin, 1918)todescribesubstances ofthis 4: 1. TheTRSisexpressedashexose; thestandardusedis type, which occur also in the tissues ofmanyother statedwherethediscrepancybetweenglucoseandfructoseis Compositae (cf. Colin, 1919). Lemoigne (1941a, important. 1942) has published a comprehensive review of Estimationofglucosebyglucoseoxidase. Aspergillus niger existing knowledge of the carbohydrates of the (NationalCollectionofTypeCultures,No.594),subcultured artichoke. onmalt-agarslopes,wasinoculatedintoflaskscontaininga In the course ofan investigation into the trans- liquidculture medium (0.5% NaNO3,0-1% MgSO4.7H20, 03%K2HPO4,10%glucose(wfv))andtheflasksincubated formations offructosepolysaccharides inthetubers wehavemadeasurveyofthecarbohydratespresent, mateas30u0r.inTghteheappeuaprtaankceeooffsmtahleleponrztyimoneswofasthefomlelodwieudmbiyn using new methods, in particular paper partition thepresenceof0g2lucose. chromatography. Although it was not our main The liquid was poured off, dialysed against running tap intentiontoinvestigatethecompositionofthetubers, waterandfilteredthroughafoldedfilterpaper(J.Barcham and some ofthe techniques employed are perhaps GreenLtd.,HayleMill,Maidstone, no.904j). The dialysed not the most suitable for that purpose, it is clear material was neutralized with NaOH and concentrated in from the results presented here that existing ideas vacuo in a water bath at 35 40°. The product was a clear aboutthetubercarbohydratesmustbemodified. A yellow liquid which contained alittle invertase activity in preliminary account of this work has been given addition to the glucose oxidase, indicated by a slow 0, (Bacon Edelman, 1949). uptakeinthepresenceofsucrose. Glucosewasestimatedin & 0-2M-acetate buffer(pH5) eithermanometrically (Keilin & Hartree, 1948) or by difference in TRS before and after METHODS incubation withtheenzyme. disSstoalnvdeadrdin8solaUttuiroantsedofb8eungzaori8c. aGcliudcsoosleutainodn f(Froulcitno,se19w2e9r)e, theEsmteimtahtoidonooffCkoelteose(.unTphuibsliwsahsedd;oncef cBolaocroimnet&ricBeallll,yu1s94i8n)g msuectrroys.e iNnowagltuecro,saencdoutlhdebceondceetnetcrtaetdiobnycghleucckoesedobxyidpaoslearii-n wgeisttheda tfrhuacttofsreucsttoasnedawrads. tChheroomnaltyogkreatposheicpreevsiednetncienstuhg-e thefructosesampleused. extracts.Themethodgavetheexpectedamountoffructose Polarimetry. The opticalrotations ofsolutions were read wthheetnuabpeprleixetdrtaoctssucbreofsoer;eiatngdavaefttehreacsiadmheydkreotloysseisv,albuuetwtihtihs iqnuaD2rrtdyemr.sweatiungbdhettshuidsneitsnelgrimcaiesnsatotaidkoienunsm.flrTaoummbptehraesscluiwgtehrstuesrofuaccruectse..oSuatmpilnetso fcrauncntootsebceomtbaikneendaasseivniidneunlcne.that it measures accurately withafreshweightof8-12g.weredriedfor24hr. at 1000; Paperpartitionchromatography afurther2thr.dryingdecreasedtheweightbyonly10-20mg. Deproteinization. Routinely, extracts weredeproteinized TheapparatususedwassimilartothatofConsden,Gordon byadding0.1vol.of30%(w/v)lead acetate (Pb(C2H302)2 & Martin (1944) and Partridge (1948). Strips of sponge 3H20)solution. Tothefiltratewasadded3% (w/v) sodium rubber were clipped roundthe tops ofthe drainpipes, and oxalate solution in the proportion 2-5: 16ml. of filtrate. asheetofplateglassrestingonthisgaveasatisfactoryair- Occasionally minimal amounts ofeachreagentwereused. tight seal. Thepipesstoodinleadoraluminiumtrays con- VoI. 48 CARBOHYDRATES OF THE ARTICHOKE 115 tainingtheaqueousphase. Largesheetsofpaperwererunin transmitted light, often showing better contrast than the wooden tanks lined with lead (for phenol and collidine). original chromatogram. The procedure was used routinely Butanol-aceticacidmixturesrapidlycorrodedthelead,and because the background colour of the chromatograms in- an aluminium tank lagged with cotton wool was used for tensifiedwithkeeping,andmadefaintspotsalmostinvisible, thissolvent. Thetroughswereconstructedofstainless steel. particularlywiththephloroglucinolreagent. Strips (15x60cm.) and sheets (60x60cm. or 57x46cm.) Quantitative estimation. Quantities (5pl.) ofthe solution ofWhatman no. 1 filterpaper were used. The solvent was tobeanalysedwereputontostripsorsheetsoffilterpaper removed from the paper by heating it in a current ofair using an 'Agla' micrometer syringe (Burroughs Weilcome inaspeciallyconstructedoven. andCo.); themeasurement hasanaccuracyof ±1%. The Solvent&. Inadditiontothesolventmixturesdescribedby paperwasrunforasuitabletime(usually2days)inbutanol- Partridge (1948), i8opropanol-aqueous NH3 (9: 1, v/v), n- aceticanddriedat60 80°. Everysecondorthirdstrip,each butanol saturated with N-aqueous NH3 and mixtures of corresponding to one application of the solution, was cut varying proportions of n-butanol-acetic acid-water were outandsprayedwithanappropriatereagent.Thepositions used. Ofallmixturesinvestigated,thatcomposedof40ml. ofthespotsintheunsprayedstripswerethendeducedand n-butanol, 10ml.aceticacidand50ml. water (called here- rectanglesfromsufficientstrips(usuallytwotofour)togive inafter'butanol-acetic') (Partridge, 1948)wasfoundtogive enough material to estimate were combined for a single themost satisfactory results with thetuber carbohydrates, estimation. Thecarbohydratewasextractedbyheatingthe andwas usedfor most ofthe qualitative and allthe quan- paperto75-80'for20min. inaknownvolumeofwaterin titative chromatography. aglass-stoppered tube, andshakingthetubevigorouslyto Reagentsfordetectionofcarbohydrates. Thedeveloped and disintegratethepaper.Theresultingsuspensionwasfiltered. dried chromatograms were sprayed with the appropriate Theestimation was carried outon asample ofthefiltrate. reagentsandheatedintheoven. (i)Phloroglucinol(Horrocks Thisprocedurewasfoundsatisfactoryforketoseestimation, &Manning,1949). Spotscontainingfreeorcombinedketose asblanksonthepapergavedensityreadingsoflessthan0-01 show pink when heated at 100-110° with this reagent. innearlyeverycase; recoveriesof95-100% were obtained Glucose is not detected. (ii) Naphthoresorcinol (Partridge, with sucrose, but lower recoveries, namely 85-95%, were 1948)andsimilarreagentsmadewithresorcinolandorcinol found with tuber extracts. Estimation ofTRS was not as were tried. Resorcinol gave a delayed colour production accurateorconvenient.Theestimationislessaccuratethan duringadayatroomtemperaturefollowingtheusualheating that used for fructose for amounts of material less than intheoven; orcinolgavegreenspotsonapinkbackground. 80,ug.,somorematerialhadtobetaken. Blankswereofthe (iii) Benzidine (Horrocks & Manning, 1949). Spots con- order of 10ptg./spot, varying with the area ofpaper, and taining free aldose groups show a chocolate brown colour werenoteliminated bywashing thepaperwith coldwater when heated at 100-120°, but glucose in easily hydrolysed before application of the solution to be estimated. Com- combinationgivesadelayedcolourproductionafterseveral binedreducing sugarwas hydrolysed afterextractionfrom days at room temperature. Fructose, either free or com- thepaperbyadding0-5ml.0-5N-HCIto40ml.ofthefiltrate bined, isdetectedinrelatively large quantitiesonly (about contained in the tube in which the estimation was to be 100itg. or more). (iv) Benzidine-trichloroacetic acid. 05g. carriedout,andheatingitinaboiling-waterbathfor30min. Benzidine (A.R.) in 10ml. acetic acid, 10ml. 40% (wlv) Thetubeswerecooledinwaterandtheacidneutralizedby aqueoustrichloroaceticacid,80ml.ethanol.Thiswasfound adding0-5ml.05N-NaOH,afterwhichalkalineferricyanide tobethemostusefulreagentforthematerialsstudied. Itis wasaddedandtheestimationcompletedbythenormalpro- very sensitive to both free and combined glucose, giving a cedure. moreintensebrowncolourwiththissugarthanthebenzidine RESULTS reagent describedabove, andwilldetect less than 1,ug. A CARBOHYDRATES OF THI ARTICHOKE TUBERS yellow colour is developed with free or combined fructose, but the reagent is appreciably less sensitive to this sugar. SourceB ofmaterial. At first, small lots oftubers (v)Anilineacidphthalate(Partridge, 1949). were purchased as they were required, during Treatment with invertase on thepaper. Sugars which are November 1948, butlaterasackfulwasboughtand attacked by invertase can be treated with this enzyme on stored in amoderately cool cellar (7-8°). Although thepaper. Chromatogramsruninonedirectioninbutanol- boughtatdifferenttimesthesetuberswereprobably acetic were sprayed with a4% (v/v) dilution of'invertase allfromthesame batch, varietyunknown. During concentrate' (BritishDrug Houses Ltd.) inwaterandhung 1949 a crop was raised from some ofthese tubers, iTnhethperoodvuecntsatof50h°ydorvoelrysaisfrweeerweasteeprarsautrefadcienftohre1u5s-u3a0lmwiany. whichwere plantedin asunnyposition on the out- byrunningthechromatogramatrightanglestotheoriginal skirts of Sheffield. The plants grew 3-3*5 m. high, direction. This treatment hydrolysed completely up to andalthoughflowerbudsformedtheydidnotopen. 200jug. ofsucrose and didnot interfere with RF values or A fewtubers were taken out ofthe ground in mid- colourdevelopment. September,whentheywerestillverysmall, butthe Photographyofchromatograms. Aftercolourdevelopment majority were left there until April 1950 when the the chromatograms were photographed: a sheet ofKodak bulk were harvested and some small tubers re- ReflexContactDocumentpaperwasplacedfacedownwards planted. In the autumn of 1949 another sackful of inclosecontactwiththechromatogram,thetwobeingheld tubers, indistinguishable from the previous year's ebleetcwtreiecnlpaimepces35ofcmp.lataeboglvaess,thaendchirlolmuamtionagtreadm.byWiat4h0eWx.- batch, waspurchased; thesewerenamed 'Bedford- posuresrangingfrom20to40sec.satisfactorynegativeswere shire Pinks' and had probably been grown in the obtained from which positives (cf. Fig. 2) were made by Midlands. 8-2 116 J. S. D. BACON AND J. EDELMAN I95I Extraction oftubers. The tubers were thoroughly seemedinourexperiencetobeadisadvantage,since scrubbed inrunning coldwater, cutintopieces and itencouraged the extraction ofgelatinous material disintegrated in a Waring blender with about half insolublein 50% (v/v) aqueousethanol. their weight ofwater. The proportion ofwater re- Deproteinization. When these experiments were quired depended to some extent on the losses of begun, the use oflead acetate and sodium oxalate waterwhichthetubershadsufferedinstorage.When wasthoughtsufficientbothtoremoveproteinandto about 10% water had been lost the tubers became destroyanyenzymnicactivity,butitwasdiscovered rubberyinconsistencyanddisproportionatelylarge thattheopticalrotationoffreshextractsclearedin amounts of extra water were needed to get satis- this way fell slowly when they were kept at room factory blending. The dry weight of tubers was temperature;simultaneouslythefreeTRSincreased. approximately20%ofthefreshweight(seeTable1). Ifthe extracts were boiled before deproteinization During the blending, and afterwards, the mash theyshowednosuchchangeinrotation.Thechange darkened, presumablythroughtheactionofphenol couldnotbeascribedtoareactionbetweencyanide oxidases, but this couldbelargelyprevented either andfreereducingsugarintheextracts; a2% (w/v) byaddingpotassiumcyanidetoafinalconcentration solution of fructose in 0-005M-potassium cyanide ofabout 0-005M, orbyremovingtheouterlayersof showedno change inrotationwhenkeptfor 2 days thetubers. A combination ofthese twoprocedures atroomtemperature. Itseemscertainthatahydro- gave almost colourless preparations. The mash lytic enzyme system was responsible, because later obtained was squeezed through gauze or mada- experiments (Edelman & Bacon, 1950) demon- pollam, yielding an opalescent liquid. A few ex- stratedthatthehydrolyticsysteminthetuberswas tracts, which are mentioned below, were made in relativelystableinthepresenceofleadacetate. All other ways. extracts to be used for analyses were accordingly heated in a boiling-water bath for 10 min. as soon Examination ofextracts aspossible after their preparation, usually reach- pH. The pH ofall extracts was about 6-5, irre- ing 80° within 10-15min. of the beginning of spective ofthematurityandageofthetubers. The blending. addition ofcalcium carbonate to the tubers during Optical rotation. The rotations of deproteinized theextractionprocesstoprotect thecarbohydrates extractsvaried considerably; Table 1shows typical from hydrolysis was therefore not necessary. Its results, with details ofthematurity and age ofthe presence when the mash was boiled with water tubers. Table 1. Compositionandopticalrotationoftuber extracts (Allextractions were carried outasdescribed underMethods, withtheexception ofthat dated 8 Feb. 1949whichwill be described later (Edelman &8 Bacon, 1950). Where dry weight determinations hadnot been made, the calculations of g. TRS aftermildhydrolysis/100 g. freshtuberweremadeassuming80%water.) Total reducing substances Optical Dry (TRS) after Ketoseas rotation [adD matter mildacid percentage corrected calculated (g./100g. hydrolysis ofTRS toundiluted onTRS Date Date Date fresh (g./100g. after juice after bought dugup extracted tuber) freshtuber) hydrolysis (2dm.tube) hydrolysis 8Nov. 1948 17Nov. 1948 15-5 -4.030* -10-40* 22Nov. 1948 23Nov. 1948 0.620 1 Dec. 1948 Dec. 1948 15*7t 1 18Dec. 1948 18Dec. 1948 14-8 78 -0*780 - 2.520 3Feb. 1949 3Feb. 1949 +1.640* 8Feb. 1949 8Feb. 1949 12*3 79 +1.590 + 5.150 8Feb. 1949 19Mar. 1949 +3.280 8Feb. 1949 4Apr. 1949 20*6 14*4 78 +0-13° + 0.380 8Feb. 1949 9May 1949 20-3 14-2 78 +1.020 + 2.850 28Sept. 1949 6Oct. 1949 18-4 14-4 91 -7.780 -22.10 28 Sept. 1949 7Nov. 1949 21*1 16-0 86 -4-150 -10.30 28Sept. 1949 24Nov. 1949 25-0 19-4 85 -3.540 - 6.840 24Nov. 1949 24Nov. 1949 16-6 14-4 73 +1-02° + 2.940 24Nov. 1949 24Nov. 1949 22-0 18*9 83 -3.870 - 8-030 5 Apr. 1950 1 May 1950 15-3 10-6 85 -0*360 - 1.430 5Apr. 1950 1 May 1950$ 14*9 10-9 83 +0.050 + 0.190 * Theseextractswerenotboiled beforedeproteinization, buttherotationswerereadimmediatelyafterwards. tt TThhies[eOxC]tDraocftthweassumgaadrelibbyerattherdowbiyngmidlidceadcitdubheyrdsroilnytsoisbowialisng-w6a4t.e8r0.andblendingthewholewhen cold. V01. 48 CARBOHYDRATES OF THE ARTICHOKE 117 It isprobable that some enzymic hydrolysis had Itwouldseemfromtheseandsimilarexperiments takenplaceduringextraction,causingasmallchange that 'inulin'wasnotpresentinsignificantamounts ofrotation in the negative direction. Experiments inextractsofthetubersobtainedinNovember 1948. inwhichthetimeofextractionintheWaringblender It is possible that the solubility of inulin in cold wasvariedindicatedthatdifferencesoftheorderof water (initselfnotaverywelldefinedproperty, cf. -0.50 (calc. for undiluted juice) might be ascribed Lemoigne, 1941b) is increased by the presence of tothiseffect,whichisthussmallcomparedwiththe inulides, but in a qualitative experiment it was seasonalvariations. Alternativemethodsofextrac- foundthatacommercialsampleofinulindissolvedin tion,e.g. byfirstthrowingdiced tubersinto boiling tuberextract,would stillprecipitate whenthe solu- water,andlaterblendingthem,gavesolutionswith tionwasfrozenandkeptcool. morepositiverotationsbutotherwiseverysimilarin Extracts made from the batch oftubers dug up composition (cf.thetwoextractsmade 1May1950). inAugust 1949showedadepositionofinulinalmost Itisbynomeanscertainthatthewholeoftheoptical atonce; solutions preparedforpolarimetryandleft activity ofextracts is due to carbohydrate. overnight had to be heated to dissolve the hazy On hydrolysis the rotation always became more precipitate which had formed even at room tem- negative, andthe 'differential' [M]Dcalculatedfrom perature. Fresh extracts showed a precipitation the change in rotation and the change in TRS for whenfrozen,butafterhavingbeenheatedtoboiling complete hydrolysis with oxalic acid at 600 was pointtodestroythehydrolyticenzymesystemthey -63.5°; that calculated for inulin (Eoc]D -40.0°) is showedamoredelayeddepositionofpolysaccharide. -53.40,andforsucrose -83.00. Itseemspossiblethatthe 'inulo-coagulase'effectof The[X]Dofthemixtureofsugarsproducedbymild Wolff(1916)maybeduetotheadditionofnucleiof acid hydrolysis of one extract was -64.8°, which aggregatedpolysaccharidetoboiledextracts. correspondsto amixture offructose andglucose in Extractsmadefromtubersgrownunderthesame theratio 4-3: 1. Thiscalculation doesnottakeinto conditions, but dug up in a more mature condition accounttheprobable formationofdifructoseanhy- several months later, showed a slight precipitation dridesduringhydrolysis (Jackson& Goergen, 1929). of inulin, but extracts made from the tubers Spontaneous precipittae.. Although 'inulin' is harvestedinApril 1950resembledthoseusedinthe almost insoluble in cold water it can be extracted winterof1948-9ingivingnoprecipitate. fromplanttissueswithouttheuseofheat,andunder In the absence of any method of determining these conditions it later appears as a dense white 'inulin'theseobservationsmaybetakentoconfirm precipitate on the walls of the vessel holding the earlierobservations (Thaysen,Bakes&Green, 1929) extract. No such precipitation was noticed with that the amount of inulin in the tubers decreases extracts made by the procedure described above during the autumn andwinter, bothrelatively and during the period from November 1948 to the absolutely. summerof1949. Anextractmadebythemethodof Precipitaion by ethanol. Although many experi- Green (1888),i.e.byboilingdicedtuberswithwater ments were carried out with a view to preparing and concentrating the extract in an evaporating polysaccharide byethanolprecipitation, to serve as basin,depositedasmallratherflocculentprecipitate a substrate for metabolic studies, it was clear that inthecourseof2months.Theprecipitatewascentri- fractionation by this means was at best very un- fugedoff,washedwithwater,anddissolvedinwater satisfactory. Additionofethanoltoaconcentration bywarmingtoabout 800. Onfreezing,thematerial greater than 50% (v/v) leads to the appearance of reprecipitated; it could be presumed to be inulin a heavy flocculent precipitate, but after this has (ketose was present), but insufficient was available been removed by filtration or centrifugation, pre- to characterizeitfurther. cipitation continues for somemonths at roomtem- Material resembling inulin was obtained from perature. Forexample, of23-4g. oftotalketose in extractstowhichethanolhadbeenadded: anequal an extract only 6-6 g. was precipitated by the volume ofethanol was added to fresh extract and addition of an equal volume of ethanol; but later the precipitate allowed to settle overnight before the filtrate deposited a precipitate from which a being filtered off. The clear filtrate, left for several substance resembling inulin was prepared (see months at room temperature, slowly deposited a above). This slow 'after precipitation' appears to translucentlayerofcarbohydrateonthewallsofthe be characteristic ofthe carbohydrates ofthe tuber flask. When an attempt was made to dissolve this (cf. discussion of the depolymerization of inulin, material in a little cold water it did not dissolve Lemoigne, 1941c), and would seem to make it im- completely,andtheinsolublefractionprovedtohave possible to define any fractions as being soluble or the properties ofinulin, i.e. it was awhite, ketose- insoluble in a given concentration of ethanol (but containing, substance, soluble in water at 800, but see, nevertheless, Tanret (1893a, b), who also notes slowlyseparatingasacompactprecipitate afterthe the considerable effects of temperature on the solutionhadbeenfrozenandleftintherefrigerator. solubility offractions). 118 J. S. D. BACON AND J. EDELMAN I95I Precipitation byacetone. Theadditionof7-20vol. Paperpartition chromatography acetone to extracts produced an immediate floccu- Qualitative. Theextractsshowedaseriesofspots, lentprecipitate, andanopalescencewhichpersisted alldetectedwitheitherphloroglucinolorbenzidine- for several days. Chromatographic analysis (see trichloroaceticsprays(seeFig.1).Freehexoses,when below) of the precipitates and supernatant fluids indicatedthatmanysubstancesare commonto the two fractions. Precipitationbyaqueousbaryta(cf.Tanret, 1893a). Spotn Aqueousbarytaaddedinexcessprecipitated 15and 2%,respectively,ofthetotalketoseoffreshextracts, andofthematerialsolublein 50% (v/v)ethanol. FreeTRS. ThefreeTRSofdeproteinizedextracts amountsusuallytoonly2-3%ofthetotalTRSafter mild acid hydrolysis. Since reducing sugar is liberated from the carbohydrates by a hydrolytic enzyme system in the extracts (Edelman & Bacon, Spot 5 1949) the exact value ofthe free TRS is probably not ofmuch significance. Values have been found Spot4 ranging from 0-25 to 0-75 g./100 g. fresh weight of tubers. Insome extractsthere has been chromato- graphicevidenceforthepresenceofmonosaccharides, butinothersitseemsthatthebulkofthefreeTRS must either be non-carbohydrate in character, or Spot 3 alternatively due to reducing end groups on some ofthe polysaccharide present. Combined TRS. The greater part, possibly all, of thecombinedreducingsugarisinaformliberatedby mild acid hydrolysis. An experiment was carried Spot2 outtodiscoverwhethermoredrasticacidhydrolysis would liberate further glucose in the extracts (see Table 2). From these results it seems that only an insignificantamountoftheglucosecanbepresentin combinationwithpyranosidiclinkages,orwithnon- carbohydrate residues. After mild acid hydrolysis the ketose content of the extracts is unchanged, and corresponds to 80-85%oftheTRS,theexactpercentagedepending onthematurityandageofthetubers (seeTable 1). SpotI The remaining TRS liberated was accounted for as glucose by the use ofglucose oxidase (see Tables 2 and 3). It is evident from these data that the carbo- Fig.1. Typicalchromatogramofextractofartichoketuber. hydrates consist essentially of non-reducing sac- Runinbutanol-aceticfor3days;sprayedwithbenzidine- charides,inwhichthemajorityoflinkagesareofthe trichloroacetic acid. The position of spot 1 corresponds furanosidic type. withthat ofsucrose(seeFig. 3). (Second positiveprint.) Table 2. Comparison ofeffecto ofweak and more drasticacidhydroly8i8 onliberation ofglucose fromartichoke-tuber extract (2.0ml.extractheatedwith2-0ml.oflON-H2SO4inboiling-waterbathfor2hr. Cooled,andneutralizedwithlON-NaOH. Further 2-0ml. heated with 04ml. 5.5% (w/v) oxalic acidin boiling-water bath for 30min. Both hydrolysates diluted to25ml. withwater. 2-0ml. ofeachsolution incubated at400in Warburg cupswith 1-2ml. 0-6M-acetate buffer (pH5), 0-3ml. glucose oxidase and0-1 ml. catalasesolutions until 2uptake ceased. Values calculatedperml. originalextract.) Glucose Glucose (by 02atN.T.P. calculated TRS Ketose difference) (MA.) (mg.) (mg.) (mg.) (mg.) Weakly hydrolysedextract 1510 23-4* 97-5 74-5 22-6 Moredrasticallyhydrolysedextract 1520 23.6* * 1mg. glucoseundertheconditionsoftheexperiment gave 02uptakeof64-5pl. VoI. 48 CARBOHYDRATES OF THE ARTICHOKE 119 Table 3. Estimation ofglucose inhydrolysedartichoke-tuber extractbyglucoseoxidase (1-0ml. hydrolysed extract (diluted x20) incubated at 400 in Warburg cup with 1-0ml. 0-2m-acetate buffer (pH5), 0-2ml. glucose oxidaseand 1 drop catalase (horse-kidney extract), untilO uptakeceased. Estimations doneon contents ofcupdilutedto50ml. Valuescalculatedperml. oforiginalextract.) Glucose Glucose calculated Non-ketose calculatedas 02uptake from O; (by disappearance (pS. at uptake Ketose TRS difference) ofTRS N.T.P.) (mg.) (mg.) (mg.) (mg.) (mg.) Untreated 79.5 101 21-5 Treatedwithglucose oxidase 1510 22.5* 80-5 78-2 22-8 * 1mg. glucose underthe conditions oftheexperimentgave 02uptakeof67-5pl. Table 4. Distributionofketo8eamongthe componentsofthetubercarbohydrate (Wherethedates correspond these analyses refertothe extracts describedin Table 1. The figures forindividual com- ponentsareinsomecasestheresultsofasingleketoseestimation, butinothersrepresentthemeanofseveral,e.g. spots 1, 2 and3for8Feb. 1949areeachthemeanoftenestimations.) TRS Ketose Ketoseas %totalketoserecovered after asper- from chromatogram hydrolysis centage r- (g./lO1 g. ofTRS Fruc- Date Date Date fresh after tose Spot Spot Spot Spot Spot Spot bought dugup extracted tuber) hydrolysis spot 1 2 3 4 5 6 8Feb. 1949 8Feb. 1949 12-3 79 10-8 10-5 11-7 10-9 10-8 16Sept. 1949 16Sept. 1949 2-2 2-5 2-5 28Sept. 1949 6 Oct. 1949 14-4 91 1-5 3-7 3-0 2-8 2-8 3-0 28Sept. 1949 17 Oct. 1949 13-3 86 4-2 5-4 3.3 4-4 4-1 4-6 28Sept. 1949 24 Oct. 1949 14-2 90 2-2 7-2 5-3 6-6 3-8 4.3 4-9 28Sept. 1949 31 Oct. 1949 15-3 82 2-6 6-3 3-9 5-0 5-3 5-8 28Sept. 1949 7Nov. 1949 16-0 86 1-3 6-6 4-2 6-3 5.5 5.9 28Sept. 1949 24Nov. 1949 19-4 85 7.7 5-0 6-5 6-6 6-7 27 Oct. 1949 23Nov. 1949 7.3 7-3 8-4 8-0 24Nov. 1949 24Nov. 1949 14-4 73 9-4 8-7 10-7 9-9 24Nov. 1949 24Nov. 1949 18-9 83 4.9 4-7 6-6 6-3 6-2 24Nov. 1949 4Jan. 1950* 7-9 7-1 9-1 24Nov. 1949 14Feb. 1950* 82 1-3 8-8 9.3 10-5 24Nov. 1949 3Mar. 1950* 1-4 9-2 7.9 9-2 24Nov. 1949 15Mar. 1950* 2-1 9.9 8-8 8-8 5Apr. 1950 1 May 1950 10-6 85 - 11-5 9-9 10-4 5Apr. 1950 1 May 1950 10-9 83 11-5 10-1 10-6 * Tuberspeeledbeforeextraction. present,occupiedpositionsbelowsucrose, cf. Fig.2. series. With butanol-acetic andphenol no evidence It is convenient to refer to the spot in the sucrose wasfoundforheterogeneity;thisisconfirmedbythe positionas'spot1',totheoneaboveitas'spot2'and behaviour of fractions of higher RF (mentioned soon,thespotwiththelowestRFbeingreferredtoas below) originally separated by the use of phenol, 'spotn'.Therewasverylittlemonosaccharide,none which showed the same number of components ofit pentose. Spot 1 had an R, indistinguishable whether run in that solvent or in butanol-acetic. fromthatofsucroseinallsolventmixturesused. It These observations do not exclude the possibility gavethebrowncolourcharacteristic offree orcom- that the spots represent mixtures of similar sub- binedglucosewithbenzidine-trichloroacetic. Using stances,particularlythoseoflowerR,, whichmust thisreagentthecolourofthehigherspotswasmore be assumed to consist of higher oligosaccharides. and more yellow as the series was ascended to The spots occupy the same relative positions in RF=0,suggestingahigherfructosetoglucoseratio. phenolasinbutanol-acetic. Totestthehomogeneityofthespots,two-dimen- Quantitative. The ketose content ofthe spots was sional chromatograms were run. Using butanol- estimatedinanumberofextracts (seeTable 4). aceticinbothdirectionsthe spotswere foundto lie The results demonstrate the even distribution of in a straight line, and there was no resolution of ketose among the components of higher R,, in- any spot into two or more components. This ex- dependentlyoftheircontributiontothetotalketose. cludes the possibility that the R,'s ofthe spots are The most noticeable deviation in this respect is influenced bythe presence ofothermembers ofthe spot 3, whichseems always to have ahigher ketose 120 J. S. D. BACON AND J. EDELMAN I95' contentthanspots2or4. Estimationsofketoseand action ofpurified preparations ofinvertase cannot ofcombinedTRSinspots1-3weremadeasdescribed be taken as evidence for the presence ofsucrose in under'Methods'(seeTable5forsometypicalresults theextracts (cf. Colin, 1919). with one extract). It willbeseen thattheratios of Partialseparationofthecarbohydrates. Astreakof fructosetoglucoseinspots2and3,calculatedonthe 1-00ml. ofboiledextract, 45cm. long, was applied assumption that the substances are non-reducing, 9-5cm. from one edge of a sheet of filter paper vary according to the basis of calculation. Small (57x47 cm.). This was done by hand in four suc- errors in the calculation of combined TRS have cessive applications from a graduated pipette with relativelylargeeffectsontheratio,butanalternative a finely drawn tip, the applications being of0-225, explanation of the discrepancies may be found in 0-33, 0-375and 0-07ml. Guidespotswereplacedat slight hydrolysis duringthe dryingprocess. Onthe eachend ofthestreak. Thesheetwasrunfor 92hr. other hand, the assumption that these spots are with phenol saturated with water, and the guide non-reducingmaybeincorrect; theymayrepresent stripscutout andsprayedwithorcinol. Because of mixtures ofreducingandnon-reducingsugars. thelargequantityofmaterialputon(101 mg.TRS) Table 5. TRSandketosedeterminations onindividualcomponents ofthetubercarbohydrate (Anextract made on 14Feb. 1950from tubers bought24Nov. 1949, deproteinizedwithPb, wasused. 5 or7 pl. spots were placed on chromatograms, andthese were run togetherin groups A, Band C, all in butanol-acetic for 3 days. The extract wasanalysedusingordinarypipettes, andalso usingthe 'Agla' syringe: 81-8 (ordinary), 81-1 (Agla) mg. TRS/ml. after hydrolysis; 67-2 (ordinary), 65-7 (Agla) mg. ketose/ml. All results are expressed in ,g./50ju. original extract; TRS iscalculatedas ,ug. hexoseon basisofafructosestandard.) ,Q r 1'.KO OI blanks from same TRS TRS sheet Ratio Ratio before after Glucoseas corrected Glucoseas fructose/ fructose/ Chroma- hydrolysis hydrolysis Ketose 1-06(q-p-r) forarea 1-06(q-r-t) glucose glucose Spot tograms (P) (q) (r) (8) (t) (u) from (8) from (u) 1 A 602 270 76 271 1-0 B 147 658 316 199 1-6 C 178 668 260 245 166 258 1-1 1-0 2 A 494 282 67 156 1-8 B 125 521 328 68 4-8 C 158 542 284 106 124 141 2-7 2-0 3 A 489 322 56 118 2-7 B 118 533 356 60 5.9 C 113 532 315 111 104 121 2-8 2-6 Treatment with invertase. When two-dimensional only the spot in the sucrose position hadseparated chromatograms oftuberextracts were treatedwith cleanly and this occupied the region between 220 invertasebetweenthefirstandseconddeveloprm,ents, and 290mm. from the point of application. The spots in the glucose and fructose positions were remaining streak was arbitrarily divided into four obtainedfromeverycomponentexceptthematerial zones by cuts 9, 45, 155 and 220mm. from the with R. approximately zero. In this case fructose startingline. The corresponding areas fromthe un- appeared, but glucose could not be detected with sprayed sheet were then cut out. The strips were certainty. This was not unexpected owing to the extractedwithwaterinvacuoat40-45O inaSoxhlet small proportion of glucose in this material (see extraction apparatus, each being extracted six to Table 6). Faint spots alsoappeared withRFvalues ninetimes. Thevolumeofwaterwassuchthatonly higherthanthatoftheoriginalspotfromwhichthey about 1 ml.wasleftintheflaskatthelastevapora- derived, but similar to original components with tion. The final liquid remaining in the extraction higher BR. Thus, for example, spot 2 gave rise to a chamber was tested for fructose by the Seliwanoff very faint spot inposition 1, andspot 5to spots in methodwithnegative oronlyveryslightlypositive positions 4and 3. Manysuch 'daughterspots'were results,indicatingalossoflessthan 1%ofthetotal slightly retarded in position when compared to fructose at this stage ofthe recovery. The concen- original componentswithsimilarR,, and, although trated extracts, which were yellow in colour, were it appears that invertase produces shorter-chain eachmadeupto5ml. Chromatogramsshowedthat oligosaccharides from each component, further fractionA (R, correspondingtothatofsucrose)was evidence is necessary to prove them identical with pure,thatBcontainedtwospots,andthatC,Dand those occurring in the tuber extract. It is obvious E wereprobably more heterogeneous. An analysis that the appearance ofreducing sugar through the ofthesefractionsisgiveninTable 6. V01. 48 CARBOHYDRATES OF THE ARTICHOKE 121 Table 6. Analysis offractionsseparatedchromatographicallyfromtuberextract (Fordetailsofexperimentsseetext, p. 120. Values calculated/ml. originalextract.) TRS* after Glucose (by Glucoseas % total hydrolysis Ketose difference x1-06) monosaccharide Fraction (mg.) (mg.) (mg.) afterhydrolysis A 15-8 7-7 8-6 52-5 B 20-75 13-0 8-2 38-7 C 28-15 22-35 6-15 21-6 D 23-25 21-0 2-4 10-3 b 10-9 10-8 0-1 (1) Totalrecovered 98-85 74-85 25i-45 Totalin original extract 101 80-0 22'0O Recovery 98% 94% - * Calculated ashexose onbasisoffructosestandard. Leaves. Theamountsoffructoseintheupperparts CARBOHYDRATESINOTHERPARTSOFTHE of the stem, and in the petioles and leaves, were ARTICHOKE PLANT lower than those in the other parts ofthe plant, so Source ofmaterial. Plantsraisedfromthe tubers that concentration oftheextractswasnecessary as describedabovewereused. Leavesweretakentothe apreliminaryto chromatographing them. The con- laboratoryasquicklyaspossibleina cooledvacuum centratedextractsfailedtogivesatisfactorychroma- flask; the stems, which were long and heavy, were tograms, the whole ofthe carbohydrate remaining cutintoshortlengths. asabloborstreak,withfewsignsofdifferentiation. Extraction and deproteinization. The stems and This effect (cf. Consden et al. 1944) could be repro- roots were extracted and the extract deproteinized duced artificially to some extent: 7,uI. spots of M- byessentiallythe sameprocedures aswereusedfor potassium dihydrogen phosphate solution were tubers. Leaves were extracted and deproteinized placed on the starting line ofa strip ofpaper, and simultaneously in the Waring blender. A typical aftertheyhaddried, 5pl.spotsofacontrolmixture extraction was as follows: 50g. of lamina were ofsugarsandofatuberextractknowntogivesatis- blendedwith 100ml. of35% (v/v) aqueousethanol factory chromatograms were applied at the same (containingpotassiumcyanide)and35ml.ofchloro- point. When run in butanol-acetic the chromato- form, N-hydrochloric acid being added cautiously gramsshowedretardationanddistortionofthespots, drop by drop to make the mash react green with thoughnotaspronouncedasthatseenwiththeleaf bromocresolgreen.Thewholemashwascentrifuged extracts. Application of 7 ,l. spots of 30% (w/v) and the upper layer (yellow with a slight tinge of lead acetate (Pb(C2H302)2.3H20) and 40% (w/v) green) wasfilteredwiththeadditionofalittlefilter barium acetate (Ba(C2H302)2.H20), which it was aid (Hyflo-Supercel, Johns-Manville Co. Ltd., thought might precipitate interfering substances, London). Such extracts gave no precipitate with hadno effect on the R,'s ofthe control mixture of trichloroacetic acid. They were adjusted to pH 7 sugars,norofthetuberextract. Itwouldthusseem before concentration in vacuo with a bath tem- that it is not salt concentration alone that is perature of500 orless. responsible for the failure to achieve satisfactory Roots. These showed the same series of com- separation (cf. Partridge, 1948). ponents asthetuberswhenchromatographed. Attempts to remove salts from the leafextracts Stems. The stem, particularlyinthe lowerparts, bytheuse ofion-exchangeresins (inwhichwe were containedasubstantialpith,whichcouldbecutout greatly helped by Dr R. E. Kressman and the without much difficulty (Thaysen et al. 1929). Permutit Company) hadonlylimited successinthe Chromatographic examination showed a series of summer of 1949. The cations were removed readily components similar to those of the tuber, both in byZeo-Karb217,buttheresultingacidsolutionwas extracts of the pith, and of the upper stem (see broughttowardsneutralityonlyslowly,evenbythe Fig. 2). As judged qualitatively there was more of more basic resins of the 'Deacidite' series (up to thecomponentsoflowR., andinulinseparatedfrom 'F'). The treated solutions, which had been cycled extracts keptintherefrigerator. repeatedly through columns of the two types of Inner and outer regions of immature tubers. The resin gave improved, but not entirely satisfactory, youngtubersbrokenaturallyintoanouterlayerand chromatograms, in which 'spot 1,, glucose and an inner core. There was no qualitative difference fructose were always seen. In one or two extracts betweentheminrespectofcarbohydrate (Fig. 2). indicationwasgivenofmaterialwithlowerRFthan 122 J. S. D. BACON AND J. EDELMAN I95I sucrose,butinnonewasthereevidenceofaseriesof family (cf. Willis, 1931) were represented (see componentsresemblingthetuberextract. Starchis Table 7). presentintheleaves (Brown &Morris, 1893). Undergroundorgans (100g.) (afterremovalofthe X 0 0 E 0 L- 4 a +j 40Jt 0 rO .00 a) O 4 L+ :3 13I-- Spot 3 Spot2 SpotI Glucose Fructose Fig. 2. Chromatograms of extracts of various parts of artichoke tubers and stems. Run in butanol-acetic for 40hr.; sprayedwith benzidine-trichloroacetic acid. Extracts madefrom plant 16Sept. 1949 unlessotherwise indicated (see Fig. 3). (Firstpositiveprint.) fibrous roots) were disintegrated in the Waring TESCOMPOITHER MEMERSblender with an equal weight of 0O01M-potassium cyanide for about 5 min. In most cases some diffi- The storage organs of other arbitrarily selected cultywasexperiencedintheblendingbecauseofthe speciesoftheCompositaewereinvestigatedchroma- fibrous or woody nature ofthe material. The most tographically. Members of both subgroups of the notable exception (except for the dahlia tubers VoI. 48 CARBOHYDRATES OF THE ARTICHOKE 123 Table 7. DetaiB ofplant8examined (AllfromtheSheffieldarea.) Dateof Partofplant collection Subfamily Systematic name Commonname examined (1949) Tubuliflorae Dahliasp. Gardendahlia 'BabyRose' Tuber 1 Sept. Tussilagofarfara L. Coltsfoot Rootstock 15June Helianthustuberosus L. Jerusalem artichoke All vegetative organs Liguliflorae Lactuca8ativaL. Lettuce, 'TomThumb' Taproot 16August Leontodonautumnali8 L. Autumnalhawkbit Rootstock 20July 26August Sonchusoleraceus L. Commonsowthistle Rootstock 20July Taraxacum officinaleWeber Dandelion Rootstock 27 April Tragopogonpratenss8 L. Goatsbeard Taproot 4July which resembled artichoke tubers in their ease of Tanret (1893b) thathis 'helianth6nine' and 'synan- handling) was Leontodon autumnalwi which had thrine' were chemical entities, since in his analysis crisp,parenchymatousrootstockswithlittlefibrous thesetwofractionsandsucroseoccurredinaratioof material. Theextracts obtained aftersqueezingthe approximately 1: 8: 2, the three constituting two- material through gauze were light-brown or yellow thirdsofthetotalcarbohydrateoftubersstoreduntil in colour, of pH about 6-0-6-5 and more or less June. opaque. They were heated in a boiling-water bath It is evident that considerable possibilities exist for 15 min. as soon as possible after preparation. for variation in over-all composition through Theseboiledextractswere concentratedinvacuoto variations in the relative proportions ofthe many athicksyrupandtakenupinwatertogivesufficient components. Inpractice this wouldseemto be the concentrationofcarbohydratetoallowofchromato- explanation for the variations in fructose, as per- graphic investigation, namely 5-10% (w/v) total centage oftotal carbohydrate, and it seems likely fructose. When extracts so concentrated were kept thattheopticalrotationofthemixturewilldepend intherefrigeratortherewasprecipitation (toalesser on similar variations, the components with higher or greater degree) of material, presumably inulin, R.probablyhavingmorepositivespecificrotations. soluble inhot butnotincoldwater. Theamountof It is not clear, however, whether any considerable this precipitate was small, except in one case. The change could occur within a given mixture of wholeconcentratedextractofLeontodonautumnalis, inulin, inulides and sucrose without an accom- however, setsolid, evenatroomtemperature, anda panying change either in the ratio of fructose to relatively large quantity of polysaccharide was glucose,orintheproportionoffreehexosepresent. isolated from it, the yield from 70ml. of original Itis difficulttoavoidtheassumptionthatallthe unconcentratedextractbeing0-7g. Inspiteofcon- carbohydrates present in the tuber bear a relation siderable salt effects (especially in the case of toinulin;thattheyrepresentaseriesterminatedby Sonchu8 oleraceu8), it was obvious that a series of inulin at one end, and bounded by sucrose at the carbohydratescomparabletothatinartichoketuber other, all members having the typical 1:2-linked extractswaspresentineverycase (seeFig. 3). fructofuranoside grouping and bearing a gluco- pyranoside as anon-reducing endgroup (I). Hirst, DISCUSSION McGilvray & Percival (1950) have reported the isolation of 2-2 of tetramethyl glucopyranoside Thecarbohydrate8 oftheartichoketuber frommethylated%dahliainulin,andhavepostulated These results demonstrate the heterogeneity ofthe a sucrose-like terminal group for the molecule. In tuber carbohydrates; they alsoprovide a basis for addition they found circumstantial evidence for theseparation and estimationofthecomponents of 2-6% of 2:4:6-trimethylglucose, which would in- higher R.. It is to be noted that the latter con- dicate the presence ofglucose within the chain (cf. stitute acQnsiderable proportionofthetotalcarbo- Irvine & Montgomery, 1933). The total ofmethy- hydrate: thefivespotswithR.'s rangingfromthat lated glucose agrees well with the percentage of ofsucrosetoabout0-025(inbutanol-acetic) contain glucose estimated by their chromatographic pro- morethanhalfthefructose ofsomeextracts, andif cedure,i.e.5-7%,butisconsiderablyhigherthanthe their higher relative content ofglucose is assumed figuresgiven by others (cf. McDonald, 1946; Bell & fromthequalitativeandquantitativedataavailable Palmer, 1949) whichlie between 1-5and 2.5%. We they would comprise an even higher proportion of have not been able to trace the source ofthe attri- the total sugar. The even distribution of fructose butionbyLemoigne (1941a)toKilianiofaformula among these components in all the extracts ex- for inulin, (C6H1005)4C12H22011, in which the group amined would seem to contradict the claims of C12H22011isintendedtorepresentsucrose.