loading

Logout succeed

Logout succeed. See you again!

ebook img

Target Selection for the LBTI Exozodi Key Science Program PDF

file size0.34 MB
languageEnglish

Preview Target Selection for the LBTI Exozodi Key Science Program

Accepted to ApJ Suppl. Series., December 12,2014 PreprinttypesetusingLATEXstyleemulateapjv.5/2/11 TARGET SELECTION FOR THE LBTI EXOZODI KEY SCIENCE PROGRAM Alycia J. Weinberger DepartmentofTerrestrialMagnetism,CarnegieInstitutionforScience,5241BroadBranchRoadNW,Washington, DC20015,USA, [email protected] Geoff Bryden JetPropulsionLaboratory,CaliforniaInstitute ofTechnology, 4800OakGroveDr,Pasadena,CA91109,USA 5 1 Grant M. Kennedy 0 Institute ofAstronomy,UniversityofCambridge,MadingleyRoad,CambridgeCB30HA,UK 2 n a Aki Roberge J Exoplanets &StellarAstrophysicsLaboratory,NASAGoddardSpaceFlightCenter,Code667,Greenbelt,MD20771, USA 6 Denis Defr`ere, Philip M. Hinz ] P StewardObservatory, UniversityofArizona,933N.CherryLane,Tucson,AZ,85721,USA E . Rafael Millan-Gabet h p NASAExoplanetScienceInstitute, CaliforniaInstituteofTechnology, Pasadena, CA,91125,USA - o George Rieke, Vanessa P. Bailey r t StewardObservatory, UniversityofArizona,933N.CherryLane,Tucson,AZ,85721,USA s a [ William C. Danchi 1 Exoplanets &StellarAstrophysicsLaboratory,NASAGoddardSpaceFlightCenter,Code667,Greenbelt,MD20771, USA v 9 Chris Haniff 1 3 CavendishLaboratory, UniversityofCambridge,JJThomsonAvenue, CambridgeCB30HE,UK 1 0 Bertrand Mennesson, Eugene Serabyn . 1 JetPropulsionLaboratory,CaliforniaInstitute ofTechnology, 4800OakGroveDr,Pasadena,CA91109,USA 0 5 Andrew J. Skemer 1 StewardObservatory, UniversityofArizona,933N.CherryLane,Tucson,AZ,85721,USA : v i X Karl R. Stapelfeldt r Exoplanets &StellarAstrophysicsLaboratory,NASAGoddardSpaceFlightCenter,Code667,Greenbelt,MD20771, USA a Mark C. Wyatt Institute ofAstronomy,UniversityofCambridge,MadingleyRoad,CambridgeCB30HA,UK ABSTRACT TheHuntforObservableSignaturesofTerrestrialplanetarySystems(HOSTS)ontheLargeBinoc- ular Telescope Interferometer will survey nearby stars for faint emission arising from 300 K dust ∼ (exozodiacal dust), and aims to determine the exozodiacal dust luminosity function. HOSTS results will enable planning for future space telescopes aimed at direct spectroscopy of habitable zone ter- restrial planets, as well as greater understanding of the evolution of exozodiacal disks and planetary systems. We lay out here the considerations that lead to the final HOSTS target list. Our target selectionstrategymaximizes the ability of the surveyto constrainthe exozodiluminosity function by selecting a combination of stars selected for suitability as targets of future missions and as sensitive exozodi probes. With a survey of approximately 50 stars, we show that HOSTS can enable an un- derstanding of the statisticaldistribution of warmdust aroundvarious types ofstars and is robustto the effects of varying levels of survey sensitivity induced by weather conditions. 2 Weinberger et al. Subject headings: circumstellar matter 1. INTRODUCTION given in Stark et al. (2014). A larger telescope can tol- erate larger zodi levels for the same integration time. The Hunt for Observable Signatures of Terrestrial Detections of warm dust will also reveal new informa- planetary Systems (HOSTS) on the Large Binocular tionaboutplanetarysystemarchitecturesandevolution. TelescopeInterferometer(LBTI)willsurveynearbystars Asteroid belts undergoing steady state collisions should for faint exozodiacal dust (exozodi). This warm circum- grind themselves down in much less time than the Gyr stellardust,suchasthatfoundinthevicinityofEarth,is ages of nearby stars. So, warm debris disks around old generatedinasteroidalcollisionsandcometarybreakups. starsmaysignallatecometaryinfluxesorstochasticcolli- We define exozodiacal dust as sitting in the habitable sionalevents(e.g.Wyatt et al.2007;G´aspa´r et al.2013). zone, that is 1 AU from a Solar-type star, and there- ∼ While 20%ofnearbystarshavecold,i.e. <150K,dust fore as having a temperature comparable to the Earth, ∼ (Eiroa et al.2013)and 15%havehot,i.e. >500K,dust i.e. 278 K. ∼ ∼ (Ertel et al. 2014), there is presently no demonstrated The goal of the LBTI HOSTS survey is to provide in- connection between the two. To understand the evolu- formation on exozodi needed to develop a future space tion of planetary systems, we seek to measure the lu- telescopeaimedatdirectdetectionofhabitablezoneter- minosity function of exozodi with age and stellar mass restrial planets (aka. exoEarths). The habitable zone is and determine whether the presence of cold outer disks defined by where a terrestrialplanet can have long-term correlates with warm inner exozodi. surfacewater,butitsexactboundariesdependonplane- LBTI is a nulling interferometer, designed to use the taryproperties. Nevertheless,surfacetemperatures near 8.4 m apertures of the LBT fixed in a common mount 300KimplythatEarth-massexoplanetsneedinsolations at a 14.4 m separation, for the detection of emission comparabletothatofEarthupto1.2timesgreaterthan fromwarmdustaroundnearbystars. LBTIworksinthe Earth’s(e.g.Leconte et al.2013;Kopparapuet al.2013). thermalinfrared,employingdualadaptivesecondariesto There is no single agreed upon definition of exozodi in correct atmospheric seeing, and providing low thermal the literature (Roberge et al. 2012). The HOSTS team background and high Strehl images to the science cam- has adopted a definition that scales the surface density era NOMIC (Hinz et al. 2008, 2012). Closed loop phase of the Sun’s Zodiacal disk at the Earth equivalent inso- tracking in the near infrared is used to stabilize the de- lation distance (EEID). Thus the surface density profile structiveinterferenceofthestaratN-band(9.8-12.4µm) expandswithstellarluminosity,andallowsthe“exozodi” anddetectfluxfromthe resolveddustdiskDefr`ere et al. level to be compared across stars of different types. See (2014). The separationof the LBT mirrors at a working thecompanionpaperKennedy et al.(2014)forafulldis- wavelength of 11 µm produces a first transmission peak cussion of our adopted model. This reference model in- centeredat79mas(1AUat13pc)andaninnerworking cludes dust interior to the habitable zone all the way in angle (half transmission) of 39 mas (1 AU at 25 pc). to the sublimation radius, so this model may test how Together, observations of thermal emission from disks close-industsuchasthatdetectedinnear-infraredinter- with LBTI and images with space-based optical coron- ferometricsurveys(Absil et al.2013;Ertel et al.2014)is agraphs capable of probing the same angular scales in related to habitable zone dust. scattered light will measure the albedo of dust grains. The typical exozodi detection from space-based pho- Albedo is one of the few available constraints on dust tometry and spectrophotometry, primarily with the IRS compositionandtherebyparentbodycompositionforde- instrument on the Spitzer Space Telescope, is 1000 ∼ brisdisks. Scatteredlightimagesofdustinthehabitable times the Solar System’s level (3 σ), i.e. 1000 zodi zonesofseveralnearbystarsmaybepossiblewithacoro- (Beichman et al. 2006; Lawler et al. 2009; Chen et al. nagraph on the WFIRST-AFTA mission (Spergel et al. 2014). The best limits from the ground-based Keck in- 2013). terferometerare500zodi(3σ)(Millan-Gabet et al.2011; Mennesson et al.2014). Interferometricsearchesfordust 2. TARGETLISTASSEMBLYANDEXCLUSIONS in the near-infrared can find dust interior to the hab- 2.1. Target Selection Goals itable zone, at temperatures &500K (Absil et al. 2013; Ertel et al.2014)orthatcomesfromscatteredlight,and Target selection for HOSTS is a balance between in- far-infrared and submillimeter telescopes can find dust cluding stars that are expected targets of a future ex- muchcoolerthan exozodi,attemperatures <100K (e.g. oEarth mission and including stars of various types to Eiroa et al. 2013). LBTI-HOSTSwill be the firstsurvey enable the best understanding of the statistical distri- capable of measuring exozodi known to be at habitable bution of exozodi over a range of parameters. The two zone temperatures and at the 10-20 zodi level (3σ). approaches are complementary and together enable in- Exozodi of this brightness would be the major source vestigations of habitable zone dust production across a of astrophysicalnoise for a future space telescope aimed range of host stellar types. atdirectimagingandspectroscopyofhabitablezoneter- The mission-driven approach concentrates on F, G, restrial planets. For example, more than about 4 zodis and K-type stars that are the best targets for fu- wouldcausetheintegrationtimeforcoronagraphicimag- ture direct observations of exoEarths, thereby providing ingofanEarth-likeplanetinthehabitablezoneofaG2V “ground truth” dust observations. The sensitivity sweet star at 10 pc to exceed 1 day, using a 4m telescope and spotforanopticalplanetimagerlieswithGandKstars the other baseline astrophysical and mission parameters because 1) the planet-to-star contrast ratio is inversely proportional to stellar luminosity and 2) the orbital ra- Target Selection for the LBTI-HOSTS Survey 3 dius of the habitable zone increases as √L∗ 1. As a re- to about 16 pc for K-type stars and about 45 pc for A- sult, M-type stars have favorable planet-to-star contrast type. ratios but habitable zones close to the stars, whereas A- Binary stars were excluded based on both technical type stars have poor contrastratios and habitable zones and scientific criteria. There are two technical reasons further from the stars. to exclude binary stars: 1) to ensure that the adaptive Not every potential target of a future exoEarth mis- optics system can easily lock on the target of interest sion can be observedwith LBTI; for one thing, many lie and 2) to ensure that flux from the companion does not in the southern hemisphere and are not observable from contaminate the area being searched for exozodi emis- LBT on Mount Graham, AZ. Furthermore, some stars sion. We therefore excluded binary stars with separa- brightenoughatvisualwavelengthsandthereforeacces- tions < 1′.′5. Some stars are known to be spectroscopic sibletoanexoEarthmissionwouldbetoofaintforLBTI binaries (SBs) but without well-measured orbits. We to achieve goodsensitivity in the limited total observing excluded all such SBs because their maximum separa- time. Ourgoalistodesignasurveythatcanfullyinform tions might fall within an angular range of 10s to 100s targetselectionforafutureexoEarthmission;surveyre- ofmasandprovideconfusingnon-nullsignals. Themain sults will have to be modeled and then extrapolated to sourcesofinformationaboutmultiplicityweretheWash- lowerdustlevels. Therefore,theremustbeobservational ington Visual Double Star Catalog (Mason et al. 2013) extensions to the mission-drivensample that will inform and the 9th Catalogue of Spectroscopic Binary Orbits models of dust evolution and aid extrapolation. (Pourbaix et al. 2009). The second approach, a LBTI sensitivity-driven ap- We further excluded stars with flux densities <1 Jy in proach,selects targets based only on the expected LBTI the broad N-band ( 11 µm) filter used for the HOSTS ∼ exozodi sensitivities, without consideration of exoEarth survey. We anticipate that the LBTI null would be de- mission constraints. This would naturally select more gradedforfainterstars. Toestimatethebrightnessofour early-typestars(AstarsandearlyF-type stars)because targets,wefitKuruczstellarmodelstoavailablephotom- they are brighter, have habitable zones at large separa- etry at BVJHK plus WISE bands W3 (12 µm) and W4 tions,andhigherFdisk/F∗ atN-band(seeKennedy et al. (22µm)andthenusedthemodeltopredictthe NOMIC (2014) for details). Therefore, the results of this type of flux density. survey would have to be extrapolated to later spectral We also only considered stars with inner habitable type targets using planet formation theory. zone distances probed by the LBTI transmission pat- Thebrightestnearbylate-FtoK-typestarscansatisfy tern, i.e. zones larger than about 60 mas. An ex- boththemissionandsensitivity-drivenselectioncriteria, ozodi disk smaller than this has low transmission ef- and we give a description of these in Section 3, we show ficiency, i.e. it is nulled along with the star because thatthereare25-48suchstars,dependingonLBTIsensi- the LBTI transmission pattern peak is at 79 mas. A ≈ tivity. WeanticipatethatHOSTSwillsurvey 50stars, general result of our brightness cuts is that our tar- ∼ given the amount of observing time allocated on LBTI, get stars are all within 28 pc. Therefore, our an- so the target selection approach followed will determine gular criterion, above, excluded binaries with separa- the rest of the observed stars. tions .50 AU. Furthermore, studies of protoplanetary Welayoutheretheconsiderationsthatleadtothefinal disk evolution indicate that stellar companions within HOSTS target list. We discuss how to balance mission- 100 AU of the primary stars cause lower disk masses driven and sensitivity considerations to maximize scien- and faster disk dissipation, possibly inhibiting planet tific return from the HOSTS project. By presenting our formation (e.g. Osterloh & Beckwith 1995; Jensen et al. target list in this early paper, we also hope to encour- 1996;Andrews & Williams2005;Harris et al.2012). We age intensive study of these stars with other techniques thereforealsoexcludedphysicalbinarieswithseparations that will eventually enhance our ability to understand <100AU. Although it would be interesting to study the the evolution of circumstellar dust with time. effect of binary separation on habitable zone dust, we emphasized the formation of an overall sample with as 2.2. Target Selection Constraints fewselectioneffectsaspossibleandeschewedinclusionof subsamples too small to provide statistically meaningful We started with a list of all bright, northern main se- results. quence stars of spectral types A through M observable Finally, we excluded giant stars (luminosity class III), from LBT (declination > 30◦) by using two catalogs: − i.e. starsthatappearsignificantlybrighterthanthemain the Unbiased Nearby Stars (UNS) sample assembled for sequence. LBTI would probe regions around these stars cold debris disks studies (Phillips et al. 2010) and the thataresignificantlylargerthanthesizeofthehabitable Hipparcos 30 pc sample assembled for exoEarth mis- zones that existed when the stars resided on the main sion planning (Turnbull et al. 2012). UNS is complete sequence andthus notdirectly comparableto the restof thesample. Table3liststhetargetsexcludedforbinarity 1 TheEEID,i.e. whereaplanetreceivesthesameincidentflux and location above the main sequence. as Earth, defines the habitable zone (see Section 3). Since the flux at the EEID is a constant, a 1 R⊕ planet there always has 2.3. Target List Categories thesameabsolutemagnitudeindependentofhoststarluminosity. However,theabsolutemagnitudeofstarsdecreases towardearlier We categorize the targets that meet the above criteria spectral type stars, thus increasing the star-to-planet flux ratio. into two samples described below in: The radial temperature dependence of a blackbody emitter in a Section 3: The Sun-like sample includes targets with stellar radiation field can be calculated by equating the incident flux (L∗/4π) with the emergent flux (4σr2EEIDT4HZ). Thus, for a spectraltypeslaterthanF5. These48starsarepotential fixed temperature, as in a habitable zone, the radius at which a targets for a future exoEarth mission. Of these 25 have blackbodyreachesthattemperatureisproportionalto√L. flux density >2 Jy at N-band. 4 Weinberger et al. Section 4: The sensitivity-driven, i.e. early-type star, 0 sample includes targets with spectral types between A0 Early−type and F4. These 20 stars provide additional information Sun−like on the exozodi luminosity function. Of these, 15 have 2 flux density >2Jy at N-band. Together, there are 68 sources in the above categories from which the optimal HOSTS survey can be created. V 4 M 3. SUN-LIKESAMPLE Our objective for this LBTI-HOSTS sub-sample is to 6 observe stars that are probable targets for a future ex- oEarth mission, based on current knowledge, and stars thatinformourunderstandingofthetypicalexozodilev- 8A0V A5V F0VF5V G0VG5V K0V K5V els aroundsimilar stars. These observations will provide 0.0 0.2 0.4 0.6 0.8 1.0 1.2 1.4 dust measurements (or upper limits) for specific stars. B − V They will also supply a larger sample of solar-type stars Figure 1. Color magnitude (absolute V magnitude versus B-V withwhichtomodelthedistributionofexozodilevelsfor color)plotofthecompletesample. Sun-likestars,definedasspec- Sun-like stars. This will enable evaluation of the suit- tral type F5 and later, are shown with green filled circles. Early ability, as exoEarth mission targets, of individual stars typestars,definedasspectraltypes F4andearlier,areshowwith bluefilled triangles. The black lineshows the MKmain sequence that could not be observed from LBTI (because, for ex- asgiveninDrilling&Landolt(2000). ample, they were too faint or too far south). Here, we define “Sun-like” as having spectral types later than or spectral type of star systems that can be searched with equal to F5. The coolest star that passed all our cuts high completeness. An interferometric mission, such as is spectral type K8. The majority of high photometric anarrayof4 4mfree-flyingmid-infraredtelescopes,pro- × quality targets for the Kepler mission’s exoplanet search vides somewhat different completeness as a function of arealso ofspectraltypes mid-K to mid-F (4500-7000K) stellar luminosity. For the HOSTS survey, we make no (Christiansen et al. 2012). assumptions aboutexoEarthdetection technology. If we The great technical challenge for direct exoEarth ob- keep the ratio of F:G:K stars fixed, the best targets for servations is to suppress the central starlight tremen- an interferometric telescope agree well with the corona- dously yet allow light from extremely faint planets to graphic telescope list (Defr`ere et al. 2010). be detected at small angular separations. Therefore, We found 48 stars that met all of our selection crite- the best systems to search for exoEarths are those ria and some of their basic properties are listed in Table with widely separated habitable zones (HZs) and with 1 and shown in Figures 1 and 2. Our current working high planet-to-star flux ratios. A full discussion of knowledge of the LBTI system is that the null quality all the considerations that go into determining a star’s will not depend on stellar brightness for stars brighter habitable zone boundaries appears in Kopparapu et al. than 2 Jy at N-band; there are 25 such bright stars on (2013). However, to first order, the location of a star’s our list. We expect that for stars fainter than 2 Jy, the HZ is set by how much light would hit an Earth-twin degradationinthenullwillbeagentlefunctionofbright- planet. Therefore, the Earth-equivalent insolation dis- ness, but this remains to be tested. tance (EEID) approximately scales in the following way Themeandistancetothesesamplestarsis11.4pc;the closest star is at 3.2 pc and the most distant at 21.4 pc. rEEID r⊕ (L⋆/L⊙)1/2 , (1) Thepresence/absenceofadiskwasnotacriterionforse- ≈ × lecting stars inthe Sun-like starsample. What is known whereListhebolometricluminosityandr⊕istheEarth- about the presence or absence of hot/warm (potentially Sun distance. N-band detectable) and cold (far-IR detectable) circum- Following Turnbull et al. (2012), the planet-to-starre- stellar disks is noted in the Table. Each dust survey has flectedfluxratioatvisiblewavelengthsforanEarth-twin somewhat different limits; the reader should consult the planet is approximately original papers for details. (Fp/F⋆)HZ ≈ (1.2×10−10)/(L⋆/L⊙) (2) 4. SENSITIVITY-DRIVEN,I.E.EARLY-TYPE,SAMPLE Soasthestellarluminosityincreases,the HZ movesout- Our objective for this sample is to find stars for which wards,increasing the separationof an exoEarthfrom its LBTIcanmakeitsmostsensitiveobservationsof 300K ∼ host star (good). However, simultaneously the planet- dust, regardless of the spectral type of the host star. To to-star flux ratio decreases, resulting in longer exposure create this sample, we select all stars that have N-band times to reach a given detection limit (bad). flux densities 1 Jy and for which the location of the ≥ Thesetwocompetingeffectslargelydictatewhichstars EEIDis>60mas. ThispreferentiallyselectsA-typeand are the best for direct observations of exoEarths. The early F-type stars. In general, these are not good ex- current consensus is that starlight suppression technolo- oEarth imaging targets themselves, because of the low giesworkingatopticalwavelengths(e.g.internalcorona- habitable-zone-planet-to-star contrast. However, they graphs)arethe mostadvanced(Greene et al.2013). For willprovideanimportantadditionto our understanding these missionconcepts, the best targets are nearbystars of the exozodiacal dust luminosity function as it might ofmid-F,G,andKspectraltypes. Ingeneral,foragiven depend on mass and luminosity of the host star. opticalcoronagraphictelescopeaperture,thelessexozodi We find an additional 20 stars that meet our selection noise contributionthat a star systemhas,the earlierthe criteria and were not already selected in the Sun-like Target Selection for the LBTI-HOSTS Survey 5 oritized list of targets will be constructed based on the EEID=60 mas targetobservability(e.g. aboveairmass1.5formorethan Sun-like 2 hr) and our expected sensitivity to exozodi. To deter- Early-type mineourexpectedsensitivity,wepassanexozodimodel, described in Kennedy et al. (2014), through an LBTI pc) null model to calculate an exozodi limit for each star, ce ( 10 in the unit of a “zodi.” This model was designed to be n Dista ssitmarpsloe,ftvoarfyaicnilgitpartoepceormtipesa,raisnodnstobhetawveeeansotbrasiegrhvtaftoiorwnsarodf correspondence with the Solar System’s actual Zodiacal cloud. The basic features of this model are a fixed sur- face density in the habitable zone, i.e. at a temperature of 278 K, and a weak power law dependence of surface density on radius from the star that matches the Zodia- 0.1 1.0 10.0 calcloud’s. Figure3showsthis estimationbasedoncur- Luminosity (L) O • rentknowledgeoftheachievableLBTInulldepth. LBTI Figure 2. Distance versus luminosity for the complete sam- is still in commissioning, so the final dependence of null ple. The black line shows an Earth equivalent insolation distance (EEID) of 60 mas. Stars that fall above this line were excluded depthontargetbrightnessisnotyetwellestablished. We because their exozodi would largely fit within the first null, and have assumed that for targets brighter than 2 Jy, LBTI thereforeLBTIwouldnotbeverysensitivetosuchdust. TheLBTI will be systematics limited, so the target’s flux density theinnerworkingangleinN-band(11µm),definedasλ/4B,is 39 mas for the LBT mirror separation of 14.4 m while the firs≈t will not affect our zodi sensitivity. However, there may transmissionpeak isat79mas. Thatstars >1L⊙ fallwellbelow be additional degradation of the null for targets of 1–2 thelineshowsthattheN-bandfluxdensityrequirementdrivesthe Jy, which comprise 28/68 of our targets. sourceselectionratherthantheEEIDrequirement. There are many other possible definitions of a “zodi” Sample. These stars are all earlier spectral type than including ones defined in terms of a fixed F /F or dust ⋆ F4 and are given in Table 2. These stars are typically L /L at a given temperature (Roberge et al. 2012). dust ⋆ further awaythan the Sun-like samples tars,withanav- For comparison purposes, we also calculate an exozodi erage distance of 18.6 pc. Twelve stars have significant sensitivity for each of our target stars by assuming a infrared excesses indicating abundant circumstellar dust version of our reference model that contains dust only at some distance from the stars; references are given in in the habitable zone, i.e. extending from 0.95 - 1.37 the table. √L∗ and normalized to a fixed Fdust/F⋆ = 5 10−5 at × a wavelength of 11 µm (for our NOMIC filter). These 5. DISCUSSION limits are also shown in Figure 3. Despite our attempts to reject known binaries (see Section 2.2), there could be unknown companions that wouldtransmitthroughtheLBTInullpatternandthere- A0V A5V F0VF5V G0VG5V K0V K5V 20 fore generate some signal. There are some ways to dis- tinguish a companion from a disk using LBTI. A com- Early−type pfrainngioen,uwnliilkletraasnpsamtiiatllpyrrimesaorlvileydtdhirsoku.gThhearesfionrgel,eaLcBomTI- dis) 15 ASultne−rnliakteive Model o z panion will produce a null that varies as the orientation y ( odfuethteopEraorjethct’sedrobtaasteiolinneovoefrtahne ionbtseerrfveraotimonet.erHcohwaenvgeers, nsitivit 10 an inclined disk would have a similar effect; therefore Se distinguishing a companion from a disk will likely re- 5 quire follow-up observations. For example, measuring the source null in narrower filters at the short and long wavelength ends of N-band, i.e. 8 and 12.5 µm, would 0 providesomeinformationonits temperatureandspatial 0.0 0.2 0.4 0.6 0.8 1.0 1.2 1.4 extent. Radial velocity observations will constrain the B − V possible masses and orbital periods of suspected com- Figure 3. Expected LBTI sensitivity (1 σ) to dust, in zodis as panions. definedinKennedyetal.(2014)andassuminganulldepthof10−4 Any companions discovered by LBTI are likely to be forthecompletesample(greenandbluecircles). Inthismodel,the surface density of the disk in the habitable zone is fixed and the of substellar mass. All but four of the Sun-like sam- fluxdensityofthediskrelativetothestaris T⋆3,soLBTIismore ple stars and seven of the Early-type sample stars have sensitivetodustaroundhotter(bluer)stars.∝Notethatthesevalues been studied extensively by radialvelocity planet search ofthesensitivityassumethatthenullislimitedbysystematicsand programs (e.g. Butler et al. 2006; Lagrange et al. 2009; not bytarget fluxdensity. Analternative definition of azodi isa fixed flux density in the habitable zone (orange squares); in this Fischer et al. 2014). At the separation of maximum caseLBTI’slimitsareonlyweaklyafunctionofstellarluminosity. transmission, i.e. 79 mas, a 80 M brown dwarf in an Jup orbitinclinedat45◦ wouldinduceatypicalreflexmotion of about 2 km s−1 for our sample stars, which could be The goal of the overall survey is not only to identify detectedforallbutthemostrapidlyrotatingstarsinthe exozodiacaldustaroundspecificstarsofinterest,butalso sample. to measure the luminosity function of disks in a general In advance ofscheduled HOSTS observingruns,a pri- statistical sense. As such, we define here a key metric 6 Weinberger et al. for the overall survey - Z10 - the fraction of stars with more than10 zodis. This levelof exozodi,versusa Solar System level of dust, would cut the number of Earth- like planets imaged by a future direct-imaging mission by half (Stark et al. 2014). This recent work also shows, however, that a mission that observes an ensemble of stars has a total planet yield that is a weak function of the exozodi level (Stark et al. 2014). In a real-world ground-based observing program, un- der changing seeing and transparency and seasonallybi- asedconditions,itwillbeimpossibletoobserveallstars, eventhosebrighterthan2Jy,to identicalzodidetection depths. Of the 68 stars in Tables 1 and 2, we expect to observe 50. What is critical is that no biases to the ∼ sample are introduced during the selection of the actual observed targets. The ability of the LBTI survey to constrain Z10 de- pends on both the number of observed targets and the sensitivity of each individual measurement. We per- formed Monte Carlo simulations to estimate the ex- pected accuracy of Z10 as a function of the num- ber of targets. Assuming that the underlying distri- Figure 4. TheabilityoftheoverallsurveytoconstrainZ10(the fractionof stars with 10 zodis of dust) depends on the number bution of disk brightnesses follows a log-normal dis- oftargetsandtheaccu≥racyofeachmeasurement. BasedonMonte tribution whose width is set by Z10, we determine Carlosimulationswefindthatasurveywithtwolevelsofsensitivity how well Z10 is constrained by the LBTI observa- -40starswith3-zodiaccuracyand30starswith10-zodiaccuracy tions. We assume that each star is treated as a (black line) - is roughly equivalent to a 50 star survey of uniform 3-zodidepth(greendashedline). unique observation. The bright end of the distribu- tion is already constrained by Spitzer/KIN/WISE ob- istration as part of its Exoplanet Exploration Program. servations (Lawler et al. 2009; Millan-Gabet et al. 2011; This work of GMK & MCW was supported by the Eu- Kennedy & Wyatt2013);therefore,wesetthefrequency ropean Union through ERC grant number 279973. This of 1000 zodi disks to be 1%. researchhas made use ofthe SIMBAD databaseandthe Atfirstweconsiderauniformsurveydepthwith3-zodi VizieR catalogue access tool, CDS, Strasbourg, France sensitivityforeachmeasurement(1-σ),whichweassume and the Washington Double Star Catalog maintained at would be the perfect, likely unachievable, survey LBTI the U. S. Naval Observatory. could perform. Figure 4 shows how well Z10 is con- 6. APPENDIX:BINARYSTARSEXCLUDEDFROM strainedbyuniform-depthsurveysrangingfrom30to70 SAMPLE stars. We find that a 50 star survey can measure Z10 We list here (Table 3) stars that could otherwise meet with 20%accuracy(for Z10 0.3-0.4). Using advanced ∼ ≃ ourselectioncriteriabutthatwereexcludedduetobina- statistical methods to allow averagingover multiple tar- rityasdescribedinSection2.2. Muchoftheinformation gets to achieve deeper zodi limits, it may be possible to in this table comes from Washington Double Star Cata- improve on these rough limits (Mennesson et al. 2014). log (Mason et al. 2001-2014). Since variations in weather will inevitably result in non-uniform sensitivity, Figure 4 also shows the con- straints on Z10 for a 2-layered survey, where 40 stars REFERENCES are observed with 3-zodi accuracy and another 30 stars with only 10-zodi accuracy. We find that this layered Absil,O.,Defr`ere,D.,duForesto,V.C.,etal.2013,A&A,A104 survey has equivalent power to reveal the zodi luminos- Andrews,S.M.,&Williams,J.P.2005, TheAstrophysical Journal,631,1134 ityfunctionasa50starsurveydonetoadepthof3zodis. Beichman,C.A.,Bryden,G.,Stapelfeldt,K.R.,etal.2006,ApJ, We conclude that an optimal observing strategy should 652,1674 not mandate uniform sensitivity, thereby concentrating Bryden,G.,Beichman,C.A.,Trilling,D.E.,etal.2006,ApJ, a large fraction of telescope time on a small number of 636,1098 stars,butwill insteadobserveagreaternumber ofstars, Bryden,G.,Beichman,C.A.,Carpenter,J.M.,etal.2009,ApJ, 705,1226 some with greater depth than others. Butler,R.P.,Wright,J.T.,Marcy,G.W.,etal.2006,ApJ,646, The HOSTS survey is expected to begin in 2015 and 505 to continue for two to three years. During commission- Chen,C.H.,Mittal,T.,Kuchner,M.,etal.2014, ApJS,211,25 ing, LBTI observed η Crv, one of the early-type sam- Chen,C.H.,Patten, B.M.,Werner,M.W.,etal.2005, ApJ, 634,1372 ple stars with a known mid-infrared excess. The ob- Christiansen,J.L.,Jenkins,J.M.,Caldwell,D.A.,etal.2012, servations demonstrate the power of LBTI to constrain PASP,124,pp.1279 thedustdistributioninthehabitablezone(Defrere et al. Defr`ere,D.,Absil,O.,denHartog,R.,Hanot, C.,&Stark,C. 2014). 2010,A&A,509,A9 Defrere,D.,Hinz,P.M.,Sekmer,A.J.,etal.2014, ApJ,inpress Defr`ere,D.,Hinz,P.,Downey,E.,etal.2014,inSPIEConference Series,Vol.9146,914609–914609–8 The Large Binocular Telescope Interferometer is Drilling,J.S.,&Landolt,A.U.2000,inAllen’sAstrophysical funded by the National Aeronautics and Space Admin- Quantities,ed.A.N.Cox(NewYork:AIPPress),381 Target Selection for the LBTI-HOSTS Survey 7 Table 1 StarsintheSun-likeStarSample HD Name RA Dec Distance Spectral EEID Fν (N-band) hot/warm cold (pc) Type (Jy) excess excess 693 6Cet 00:11:15.86 -15:28:04.7 18.7 F8V 0.095 1.15 n(E13) 4628 00:48:22.98 +05:16:50.2 7.5 K2.5V 0.072 1.30 n(T08) 9826 υ And 01:36:47.84 +41:24:19.6 3.5 F9V 0.136 2.36 n(A13) n(B06,E13) 10476 107Psc 01:42:29.76 +20:16:06.6 7.5 K1V 0.090 2.02 n(MG11) n(T08) 10700 tauCet 01:44:04.08 -15:56:14.9 3.6 G8.5V 0.182 5.42 y(A13) y(G04) 10780 GJ75 01:47:44.83 +63:51:09.0 10.1 K0V 0.072 1.12 n(L09) 16160 GJ105 02:36:04.89 +06:53:12.7 7.2 K3V 0.073 1.53 n(T08) 16895 13Per 02:44:11.99 +49:13:42.4 11.1 F7V 0.138 2.43 n(A13) n(Be06) 17206 tau01Eri 02:45:06.19 -18:34:21.2 14.2 F75 0.115 1.69 n(T08) 19373 iotPer 03:09:04.02 +49:36:47.8 10.5 F9.5V 0.141 2.85 n(MG11) n(T08) 22049 epsEri 03:32:55.84 -09:27:29.7 3.2 K2V 0.172 7.39 n(A13) y(B09) 22484 LHS1569 03:36:52.38 +00:24:06.0 14.0 F8V 0.127 2.35 y(A13) y(T08) 23754 tau06Eri 03:46:50.89 -23:14:59.0 17.6 F5IV-V 0.128 2.10 n(G13) 26965 omiEri 04:15:16.32 -07:39:10.3 5.0 K0.5V 0.128 3.51 n(L02) 30652 1Ori 04:49:50.41 +06:57:40.6 8.1 F6V 0.205 4.76 n(A13) n(T08) 32147 05:00:49.00 -05:45:13.2 8.7 K3V 0.059 1.00 n(L09) 34411 lamAur 05:19:08.47 +40:05:56.6 12.6 G1.5IV 0.105 1.80 n(MG11) n(T08) 35296 V1119Tau 05:24:25.46 +17:23:00.7 14.4 F8V 0.090 1.03 n(T08) 38393 gamLep 05:44:27.79 -22:26:54.2 8.9 F6V 0.175 4.40 n(MG11) n(Be06) 48737 ksiGem 06:45:17.36 12:53:44.13 18.0 F5IV 0.196 4.34 n(A13) n(K13) 78154 sig02UmaA 09:10:23.54 +67:08:02.4 20.4 F6IV 0.099 1.24 n(G13) 84117 GJ364 09:42:14.42 -23:54:56.0 15.0 F8V 0.093 1.11 n(E13) 88230 NSV4765 10:11:22.14 +49:27:15.3 4.9 K8V 0.065 1.91 n(MG11) n(T08) 89449 40Leo 10:19:44.17 +19:28:15.3 21.4 F6IV 0.098 1.10 n(G13) 90839 36Uma 10:30:37.58 +55:58:49.9 12.8 F8V 0.099 1.25 n(T08) 95128 47Uma 10:59:27.97 +40:25:48.9 14.1 G1V 0.091 1.35 n(MG11) n(T08) 101501 61Uma 11:41:03.02 +34:12:05.9 9.6 G8V 0.081 1.24 n(G03) 102870 betVir 11:50:41.72 +01:45:53.0 10.9 F9V 0.173 4.30 n(A13) n(T08) 115617 61Vir 13:18:24.31 -18:18:40.3 8.6 G7V 0.108 2.20 n(L09,E14) y(L09) 120136 tauBoo 13:47:15.74 +17:27:24.8 15.6 F6IV 0.114 1.67 n(E14) n(B09) 126660 tetBoo 14:25:11.8 +51:51:02.7 14.5 F7V 0.147 3.12 n(T08) 131977 KXLib 14:57:28.00 -21:24:55.7 5.8 K4V 0.076 1.95 n(L09) n(Be06) 141004 lamSer 15:46:26.61 +07:21:11.0 12.1 G0IV-V 0.121 2.40 n(A13) n(K10) 142373 LHS3127 15:52:40.54 +42:27:05.5 15.9 F8Ve 0.111 2.03 n(A13) n(T08) 142860 gamSer 15:56:27.18 +15:39:41.8 11.2 F6IV 0.151 2.93 n(A13) n(T08) 149661 V2133Oph 16:36:21.45 -02:19:28.5 9.8 K2V 0.068 1.00 n(E14) n(T08) 156026 V2215Oph 17:16:13.36 -26:32:46.1 6.0 K5V 0.064 1.64 n(Be06) 157214 wHer 17:20:39.30 +32:28:21.2 14.3 G0V 0.079 1.01 n(T08) 160915 58Oph 17:43:25.79 -21:40:59.5 17.6 F5V 0.096 1.18 n(E14) n(E14) 173667 110Her 18:45:39.72 +20:32:46.7 19.2 F6V 0.131 2.18 y(A13) n(T08) 185144 sigDra 19:32:21.59 +69:39:40.2 5.8 G9V 0.113 2.72 n(A13) n(T08) 192310 GJ785 20:15:17.39 -27:01:58.7 8.9 K2+V 0.071 1.25 n(Be06) 197692 psiCap 20:46:05.73 -25:16:15.2 14.7 F5V 0.136 2.08 n(E14) n(L09) 201091 61CygA 21:06:53.95 +38:44:58.0 3.5 K5V 0.106 4.43 n(A13) n(G04) 201092 61CygB 21:06:55.26 +38:44:31.4 3.5 K7V 0.085 3.28 n(A13) n(G04) 215648 ksiPegA 22:46:41.58 +12:10:22.4 16.3 F7V 0.132 2.22 n(E14) n(G13) 219134 23:13:16.98 +57:10:06.1 6.5 K3V 0.080 1.86 n(T08) 222368 iotPsc 23:39:57.04 +05:37:34.6 13.7 F7V 0.137 2.40 n(MG11) n(B06) Note. — Excess References: A13=Absiletal. (2013); Be06=Beichmanetal. (2006);B06=Brydenetal. (2006); B09=Brydenetal.(2009);E13=Eiroaetal.(2013);E14=Erteletal.(2014);G13=G´aspa´retal.(2013);G03=Greaves &Wyatt (2003); G04=Greaves etal. (2004); K13=Kennedy&Wyatt (2013); K10=Koerneretal. (2010);L02=Laureijsetal. (2002); L09=Lawleretal.(2009);MG11=Millan-Gabetetal.(2011);T08=Trillingetal.(2008) Eiroa,C.,Marshall,J.P.,Mora,A.,etal.2013, A&A,555,11 Hinz,P.,Arbo,P.,Bailey,V.,etal.2012, inSocietyof Ertel,S.,Absil,O.,Defr`ere,D.,etal.2014, A&A,570,A128 Photo-Optical Instrumentation Engineers(SPIE) Conference Fajardo-Acosta,S.B.,Telesco,C.M.,&Knacke,R.F.1998, AJ, Series,Vol.8445,SocietyofPhoto-OpticalInstrumentation 115,2101 Engineers(SPIE)ConferenceSeries,0 Fischer,D.A.,Marcy,G.W.,&Spronck,J.F.P.2014,ApJS, Hinz,P.M.,Solheid,E.,Durney,O.,&Hoffmann,W.F.2008,in 210,5 SocietyofPhoto-OpticalInstrumentation Engineers(SPIE) G´aspa´r,A.,Rieke,G.H.,&Balog,Z.2013,ApJ,768,25 ConferenceSeries,Vol.7013,SocietyofPhoto-Optical Gillett,F.C.1986,inAstrophysicsandSpaceScienceLibrary, Instrumentation Engineers(SPIE)ConferenceSeries,39 Vol.124,LightonDarkMatter,ed.F.P.Israel,61–69 Jensen,E.L.N.,Mathieu,R.D.,&Fuller,G.A.1996,ApJ,458, Greaves,J.S.,Holland,W.S.,Jayawardhana, R.,Wyatt, M.C., 312 &Dent,W.R.F.2004,MNRAS,348,1097 Kennedy,G.M.,&Wyatt, M.C.2013, MNRAS,433,2334 Greaves,J.S.,&Wyatt, M.C.2003,MNRAS,345,1212 Kennedy,G.M.,Wyatt, M.C.,Bryden,G.,etal.2014,TBD,in Greene,T.,Noecker,C.,&ExoPAGSAG5team.2013, ArXiv press e-prints Koerner,D.W.,Kim,S.,Trilling,D.E.,etal.2010,ApJ,710, Harris,R.J.,Andrews,S.M.,Wilner,D.J.,&Kraus,A.L.2012, L26 ApJ,751,115 8 Weinberger et al. Table 2 StarsintheSensitivity-DrivenSample HD Name RA Dec Distance Spectral EEID Fν (N-band) hot/warm cold (pc) Type (Jy) excess excess HD33111 betEri 05:07:51.0 -05:05:11.2 27.4 A3IV 0.248 3.72 n(E14) y(G13) HD38678 zetLep 05:46:57.3 -14:49:19.0 21.6 A2IV-V 0.176 2.06 y(FA98), n(A13) y(FA98) HD40136 etaLep 05:56:24.3 -14:10:03.7 14.9 F2V 0.161 2.36 y(L09) HD81937 hUMa 093131.7 +63:03:42.8 23.8 F0IV 0.168 2.55 n(B06) HD95418 betaUMa 11:01:50.5 +56:22:56.7 24.4 A1IV 0.316 4.20 y(FA98), n(A13) y(S06) HD97603 delLeo 11:14:06.5 +20:31:25.4 17.9 A5IV 0.278 3.90 n(A13) n(G13) HD102647 betLeo 11:49:03.6 +14:34:19.4 11.0 A3V 0.336 6.85 y(A13) y(S06) HD103287 gamUma 11:53:49.8 +53:41:41.1 25.5 A1IV 0.308 3.69 n(S06) HD105452 alfCrv 12:08:24.8 -24:43:44.0 14.9 F1V 0.139 1.97 n(G13) HD106591 delUMa 12:15:25.6 +57:01:57.4 24.7 A2V 0.199 2.00 n(A13) n(G13) HD108767 delCrv 12:29:51.8 -16:30:55.6 26.6 A0IV 0.251 2.25 y(E14) n(S06) HD109085 etaCrv 12:32:04.2 -16:11:45.6 18.3 F2V 0.125 1.76 n(A13) y(W05) HD128167 sigBoo 14:34:40.8 +29:44:42.4 15.8 F2V 0.117 1.39 y(L02) HD129502 107Vir 14:43:03.6 -05:39:29.5 18.3 F2V 0.151 2.60 n(E14) n(G13) HD164259 zetSer 18:00:29.0 -03:41:25.0 23.6 F2IV 0.106 1.14 n(E14) n(L09) HD172167 Vega 18:36:56.3 +38:47:01.3 7.7 A0V 0.916 38.55 y(A13) y(G86) HD187642 Altair 19:50:47.0 +08:52:06.0 5.1 A7V 0.570 21.63 y(A13) n(R05) HD203280 Alderamin 21:18:34.8 +62:35:08.1 15.0 A8V 0.294 7.04 y(A13) n(C05) HD210418 tetPeg 22:10:12.0 +06:11:52.3 28.3 A1V 0.179 1.61 n(E14) n(S06) HD216956 Fomalhaut 22:57:39.0 -29:37:20.0 7.7 A4V 0.504 15.41 y(L13) y(G86) Note. — Excess References: A13=Absiletal. (2013); B06=Brydenetal. (2006); C05=Chenetal. (2005); E14=Erteletal. (2014); FA98=Fajardo-Acostaetal. (1998); G13=Ga´spa´retal. (2013); G86=Gillett (1986); L02=Laureijsetal. (2002); L09=Lawleretal. (2009); L13=Lebretonetal.(2013);R05=Riekeetal.(2005);S06=Suetal.(2006);W05=Wyattetal.(2005) Kopparapu,R.K.,Ramirez,R.,Kasting,J.F.,etal.2013,ApJ, Pourbaix,D.,Tokovinin,A.A.,Batten, A.H.,etal.2009,VizieR 765,131 OnlineDataCatalog,1,2020 Lagrange,A.-M.,Desort,M.,Galland,F.,Udry,S.,&Mayor,M. Rieke,G.H.,Su,K.Y.L.,Stansberry,J.A.,etal.2005,ApJ, 2009, A&A,495,335 620,1010 Laureijs,R.J.,JourdaindeMuizon,M.,Leech, K.,etal.2002, Roberge,A.,Chen,C.H.,Millan-Gabet,R.,etal.2012,PASP, A&A,387,285 124,799 Lawler,S.M.,Beichman,C.A.,Bryden,G.,etal.2009,ApJ, Spergel,D.,Gehrels,N.,Breckinridge,J.,etal.2013, ArXiv 705,89 e-prints Lebreton,J.,vanLieshout,R.,Augereau,J.-C.,etal.2013,A&A, Stark,C.C.,Roberge,A.,Mandell,A.,&Robinson,T.D.2014, 555,A146 ApJ,795,122 Leconte, J.,Forget,F.,Charnay,B.,Wordsworth,R.,&Pottier, Su,K.Y.L.,Rieke,G.H.,Stansberry,J.A.,etal.2006,ApJ, A.2013, Nature,504,268 653,675 Mason,B.D.,Wycoff, G.L.,Hartkopf,W.I.,Douglass,G.G.,& Trilling,D.E.,Bryden,G.,Beichman,C.A.,etal.2008,ApJ, Worley,C.E.2013, VizieROnlineDataCatalog,1,2026 674,1086 Mennesson,B.,Millan-Gabet,R.,Serabyn, E.,etal.2014,ApJ, Turnbull,M.C.,Glassman,T.,Roberge,A.,etal.2012,PASP, 797,119 124,418 Millan-Gabet,R.,Serabyn,E.,Mennesson,B.,etal.2011,ApJ, Wyatt, M.C.,Greaves,J.S.,Dent,W.R.F.,&Coulson,I.M. 734,67 2005,ApJ,620,492 Nidever,D.L.,Marcy,G.W.,Butler,R.P.,Fischer,D.A.,& Wyatt,M.C.,Smith,R.,Greaves,J.S.,etal.2007,ApJ,658,569 Vogt, S.S.2002,ApJS,141,503 Osterloh,M.,&Beckwith,S.V.W.1995,ApJ,439,288 Phillips,N.M.,Greaves,J.S.,Dent,W.R.F.,etal.2010, MNRAS,403,1089 Target Selection for the LBTI-HOSTS Survey 9 Table 3 BinaryStarsExcludedfromtheSample HD Name SpTyp BinarityNotes HD432 betCas F2IV WDSsaysSBwithP=27d HD4614 etaCas G3V VB12”,70AU,P=480yr HD6582 muCas G5V VB1”,7.5AU+SB HD8538 delCas A5III-IV SB,perhapseclipsing HD11443 alfTri F6IV SB,P=1.8d HD11636 betAri A5V SB9,P=107d HD13161 A5IV SB,P=31d,resolvedbyMarkIII HD13974 G0V SB,P=10d HD16970 A2V VB,2.3” HD20010 F6V VB4.4”,62AU HD20630 kap01Cet G5V WDSsaysSB,butnotvariableinNideveretal.(2002) HD39587 chi1Ori G0V VB0.7”,6AU,P=14yr HD40183 A1IV-V SB,P=3.7d,resolvedbyMarkIII HD47105 A1.5IV SB/speckleVB HD48915 Sirius A0V VB,7.5” HD56986 delGem F2V SB,P=6.1yr HD60179 CastorA A1.5IV SB,P=9.2dplusVB,P=467yr HD61421 Procyon F5IV VB5”,18AU,P=40yrandSB HD76644 A7V SB,P=11yr HD76943 10UMa F3V SB/VB0.6”,P=21.8yr HD82328 tetUMa F7V WDSsaysSB(SBC7), butnotinSB9,alsoVB,5” HD82885 SVLmi G8III VB3.8”,43AU,P=200yr HD95735 M2V EB HD98231 GJ423A G0V Complicatedmultiplesystem HD104304 G8IV VB,1” HD109358 betCvn G0V SB,0.1”,1.3AU HD110379 GJ482A F0V VB,3.75”,44AU,P=171yr HD112413 alf02CVn A0II-III SB HD114378J alphCom F5V VB0.7”,12AU,P=26yr HD114710 betCom G0V possibleSB HD116656 MizarA A1.5V SB,P=20.5d HD118098 zetVir A3V VB,companionisM4-M7 HD121370 etaBoo G8V SB9,P=494d HD130841 alfLibA A4IV-V possibleSB HD131156 37Boo G8V VB4.9”,33AU,P=151yr HD131511 GJ567 K2V possibleSBP=125d HD133640 GJ575 G0V VB,3.8”,48AU(nowat1.5”) HD139006 alfCrB A1IV SB,P=17d HD140538 G2.5V VB,4.4”,65AU HD144284 tetDra F8IV-V SB,P=3.1d HD155125 A2IV-V VB0.86” HD155886 GJ663A K2V VB5”,28AU HD155885 36Oph K2V VB15”,87AU,P=569yr+possibleSB HD156164 delHer A1IV SB0.1” HD156897 40Oph F2V VB,approx4”(CCDM) HD159561 alfOph A5II VB0.8” HD160269 G0V VB1.5”,21AU HD160346 GJ688 K3V SBP=84d HD161797 muHer G5IV VB1.4”,12AU,P=65yr HD165341 70OphA K0V VB4.6”,23AU,P=88yr HD165908 bHer F7V VB1.1”,17AU,P=26yr HD170153 F7V SB0.1”,1AU,P=0.8yr CCDM19026-2953A A2.5V VB0.53” HD177724 A0IV-V SB+VB,5” HD182640 delAql F1IV-V SB,resolvedat0.1” HD185395 tetCyg F4V VB/SB,approx2.5” HD207098 delCap F2III EB HD210027 iotPeg F5V SB1,P=10d HD224930 85Peg G5V VB0.8”,10AU,P=26yr

See more

The list of books you might like