Logout succeed
Logout succeed. See you again!
Peptidases and Neuropeptide Processing PDF
Preview Peptidases and Neuropeptide Processing
Contributors to Volume 23 Article numbers are in parentheses following the names of contributors. Affiliations listed are current. DRAHCIR G. ALLEN (11), Center of Research on Occupational and Environ- mental Toxicology, Oregon Health Sciences University, Portland, Oregon 10279 H. ILLERAB (21), Institut de Pharmacologie Mol6culaire et Cellulaire, Cen- tre National de la Recherche Scientifique, 06560 Valbonne, France KaY SENRAB (20), Department of Biochemistry and Molecular Biology, University of Leeds, Leeds LS2 9JT, United Kingdom K. ~IEHTJtERYEB (18), Center for Molecular Biology, University of Heidel- berg, D-6900 Heidelberg, Germany HaMaoi ATTESSUOB (9), Biochimie des Signaux R6gulateurs Cellulaires et Mol6culaires, Universit6 Pierre et Marie Curie, F-75006 Paris, France NACNUD J. ~UEBVMAC (19), St. Vincent's Institute of Medical Research, Fitzroy, Victoria 3065, Australia SIEW YEEN IAI-IC (22), Department of Medicine, University of Melbourne, Austin Hospital, Melbourne, Victoria 3048, Australia F. trELCEI-IC (21), Institut de Pharmacologie Mol6culaire et Cellulaire, Cen- tre National de la Recherche Scientifique, 06560 Valbonne, France LUAP NEHOC (9), Biochimie des Signaux R6gulateurs Cellulaires et Mol6cu- laires, Universit6 Pierre et Marie Curie, F-75006 Paris, France ~rEVw'aS R. YBSORC (8), School of Biomolecular Sciences, Liverpool John Moores University, Liverpool L3 3AF, United Kingdom P. Dauci-i (21), Institut de Pharmacologie Mol6culaire et Cellulaire, Centre National de la Recherche Scientifique, 06560 Valbonne, France TREBOR YAD (2), Laboratory of Biochemical Neuroendocrinology, Clinical Research Institute of Montreal, Montreal, Quebec, Canada H2W 7R1 V. DIw (21), CEN de Saclay, 91191 Gif s/s Yvette, France EEtrAM-NNA ~rACNUD (19), St. Vincent's Institute of Medical Research, Fitzroy, Victoria 3065, Australia xi CONTRIBUTORS OT VOLUME 32 DYOLL D. REKCIRF (13), Department of Molecular Pharmacology, Albert Einstein College of Medicine, Bronx, New York 16401 S. J. FULLER (18), Department of Pathology, University of Melbourne, Parkville, Victoria 3052, Australia DLORAH RENIAG (10), Laboratory of Neurochemistry, National Institute of Neurological Disorders and Strokes, National Institutes of Health, Be- thesda, Maryland 20892 NOSILA M. NOSBIG (16), Medical Research Council, Neurochemical Pathol- ogy Unit, Newcastle General Hospital, Newcastle Upon Tyne NE4 6BE, United Kingdom CRAM J. NAMSKCULG (17), Fishberg Research Center in Neurobiology, Mount Sinai School of Medicine, New York, New York 92001 OADAS ARUMIK (14), Center for Biomedical Science, School of Medicine, Chiba University, Chiba 260, Japan ANEHTA SIDALK (19), St. Vincent's Institute of Medical Research, Fitzroy, Victoria 3065, Australia ENNA C. ECNERWAL (19), Department of Biology, Medawar Building, Uni- versity College London, London WC1E 6BT, United Kingdom ACCEBER A. WEL ,7( 12), Peptide Biology Laboratory, Baker Medical Re- search Institute, Prahran, Victoria 3181, Australia SIRI GREBDNIL (5), Department of Biochemistry and Molecular Biology, Louisiana State University Medical Center, New Orleans, Louisiana 70112 KRAM O. YLEVIL (10), Department of Biochemistry, Bowman Gray School of Medicine, Wake Forest University, Winston-Salem, North Carolina 75172 DRAHCIR E. SNIAM (6), Department of Neuroscience, The Johns Hopkins University School of Medicine, Baltimore, Maryland 50212 C. L. SRETSAM (18), Department of Pathology, University of Melbourne, Parkville, Victoria 3052, Australia Y. OUSAM (21), Takeda Chemical Industries, Ltd., Pharmaceutical Group, Tsukuda 300-42, Japan NHOJ R. TNOMREDCM (16), Medical Research Council, Neurochemical Pa- thology Unit, Newcastle General Hospital, Newcastle Upon Tyne NE4 6BE, United Kingdom CONTRIBUTORS TO VOLUME 32 xi KCIREDERF A. O. NHOSLEDNEM (22), Department of Medicine, University of Melbourne, Austin Hospital, Melbourne, Victoria 3048, Australia ANAIRAM SIRROM (10), Department of Physiology and Pharmacology, Bow- man Gray School of Medicine, Wake Forest University, Winston-Salem, North Carolina 75172 TERRY J. OPGENORTH (14), Aging and Degenerate Disease Research, Abbott Laboratories, Abbott Park, Illinois 46006 NHOJ E. RATNIP (3), Department of Neuroscience and Cell Biology, Univer- sity of Medicine and Dentistry of New Jersey-Robert Wood Johnson Medi- cal School, Piscataway, New Jersey 45880 G. DEER (18), Department of Pathology, University of Melbourne, Parkville, Victoria 3052, Australia DEMAHOM MALOHR (9), Biochimie des Signaux R6gulateurs Cellulaires et Mol6culaires, Universit6 Pierre et Marie Curie, F-75006 Paris, France SEMAJ L. STREBOR (17), Fishberg Research Center in Neurobiology, Mount Sinai School of Medicine, New York, New York 92001 NITRAM K.-H. ,g,HCS REF (2), Department of Anatomy and Cell Biology, Phillips University of Marburg, D-35037 Marburg, Germany LIBAN G. SEIDAH (1), Laboratory of Biochemical Neuroendocrinology, Clinical Research Institute of Montreal, Montreal, Quebec, Canada H2W 7R1 RUHTRA SEKLUHS (15), Department of Surgery, University of Melbourne, Melbourne, Victoria 3084, Australia D. H. LLAMS (18), Department of Pathology, University of Melbourne, Parkville, Victoria 3052, Australia A. NAI HTIMS ,7( 12), Peptide Biology Laboratory, Baker Medical Research Institute, Prahran, Victoria 813 l, Australia ENNAILUJ KCATS (11), The Vollum Institute, Oregon Health Sciences Uni- versity, Portland, Oregon 10279 YRAG SAMOHT (4), Vollum Institute, Oregon Health Sciences University, Portland, Oregon 10279 LERUAL SAMOHT (4), Vollum Institute, Oregon Health Sciences University, Portland, Oregon 10279 Xll ~176 CONTRIBUTORS TO VOLUME 32 YNOHTNA J. RENRUT (20), Department of Biochemistry and Molecular Biol- ogy, University of Leeds, Leeds LS2 9JT, United Kingdom YDUJ K. EKYLSNAV (4), Vollum Institute, Oregon Health Sciences Univer- sity, Portland, Oregon 10279 B. TNECNIV (21), Institut de Pharmacologie Mol6culaire et Cellulaire, Cen- tre National de la Recherche Scientifique, 06560 Valbonne, France J. P. TNECNIV (21), Institut de Pharmacologie Mol6culaire et Cellulaire, Centre National de la Recherche Scientifique, 06560 Valbonne, France A. NNAMEDIEW (18), Center for Molecular Biology, University of Heidel- berg, D-6900 Heidelberg, Germany NUYHSNIJ R. Wu-WON6 (14), Aging and Degenerative Diseases Research, Abbott Laboratories, Abbott Park, Illinois 60064 NIM GNEHZ (3), Department of Anatomy and Cell Biology, Columbia Uni- versity College of Physicians and Surgeons, New York, New York 23001 YI ZHOU (5), Department of Biochemistry and Molecular Biology, Louisi- ana State University Medical Center, New Orleans, Louisiana 70112 Preface The generation of bioactive peptides from inactive precursor molecules involves a series of highly ordered, enzyme-mediated processing events. The posttranslational modifications can occur within the cell at the point of secretion or postsecretion. The precise pattern of processing for any given precursor also can vary, depending on the site of expression and/or stage of development, reflecting the differential expression of processing enzymes. The last decade or so has seen the characterization of both peptide products and the majority of the processing enzymes involved in their production, thus facilitating the development of various biochemical, immunological, and molecular probes necessary to characterize these complex pathways in greater detail. The aim of this volume in the Methods in Neurosciences series is to describe in a very practical way the "state-of-the-art" technology being developed and applied in the field of peptidases and neuropeptide process- ing. It is divided into three sections. The first, "Molecular Approaches for the Study of Intracellular Processing Enzymes," covers strategies for the molecular characterization of processing enzymes, including cloning, ex- pression, localization by in situ hybridization, and the use of antisense mRNA to block enzyme expression. The second, "Immunological and Bio- chemical Approaches to the Study of Peptide-Processing Pathways," de- scribes the combination of more classical approaches such as immunoas- says, HPLC, and the use of specifically modified substrates to characterize both the precise pattern of peptide products in a given tissue and the regula- tion and distribution of the enzymes involved in their generation. Finally, the last section, "Identification and Characterization of Extracellular Process- ing Enzymes in the Central Nervous System," is designed to provide an insight into, as well as strategies for, the investigation of this exciting and developing area in which extracellular enzymes can generate, modulate, or terminate peptide signals in the central nervous system. In this book, like others in the series, the authors have been encouraged to provide chapters that reflect the latest techniques being developed in their laboratories, with their own specific scientific interests providing the practi- cal application. Each chapter provides sufficient detail to allow the experi- mental procedures to be easily duplicated, although, for practical reasons, lengthy operating procedures for common laboratory equipment have been omitted. Absolute conditions for any given experiment are inevitably deter- mined empirically; however, it is hoped that this volume will provide both iiix xiv PREFACE the student and experienced researcher a valuable starting point in develop- ing strategies for the study of peptidases and neuropeptide processing. I would like to express my appreciation to the Baker Medical Research Institute for supporting the production of this work. Appreciation is also expressed to my fellow authors for the high standard of their contributions and for meeting their deadlines. A. IAN SMITH Methods in Neurosciences Volume 1 Gene Probes Edited by P. Michael Conn Volume 2 Cell Culture Edited by P. Michael Conn Volume 3 Quantitative and Qualitative Microscopy Edited by P. Michael Conn Volume 4 Electrophysiology and Microinjection Edited by P. Michael Conn Volume 5 Neuropeptide Technology: Gene Expression and Neuropeptide Receptors Edited by P. Michael Conn Volume 6 Neuropeptide Technology: Synthesis, Assay, Purification, and Processing Edited by P. Michael Conn Volume 7 Lesions and Transplantation Edited by P. Michael Conn Volume 8 Neurotoxins Edited by P. Michael Conn Volume 9 Gene Expression in Neural Tissues Edited by P. Michael Conn Volume 01 Computers and Computations in the Neurosciences Edited by P. Michael Conn Volume 11 Receptors: Model Systems and Specific Receptors Edited by P. Michael Conn Volume 21 Receptors: Molecular Biology, Receptor Subclasses, Localization, and Ligand Design Edited by P. Michael Conn Volume 31 Neuropeptide Analogs, Conjugates, and Fragments Edited by P. Michael Conn Volume 41 Paradigms for the Study of Behavior Edited by P. Michael Conn Volume 51 Photoreceptor Cells Edited by Paul A. Hargrave Volume 61 Neurobiology of Cytokines (Part )A Edited by Errol B. De Souza Volume 71 Neurobiology of Cytokines (Part )B Edited by Errol B. De Souza Volume 81 Lipid Metabolism in Signaling Systems Edited by John N. Fain Volume 91 Ion Channels of Excitable Membranes Edited by Toshio Narahashi VX xvi VOLUMES IN SERIES Volume 02 Pulsatility in Neuroendocrine Systems Edited by Jon E. Levine Volume 12 Providing Pharmacological Access to the Brain: Alternate Approaches Edited by Thomas R. Flanagan, Dwaine F. Emerich, and Shelley R. Winn Volume 22 Neurobiology of Steroids Edited by E. Ronald deKloet and Win Sutanto Volume 32 Peptidases and Neuropeptide Processing Edited by A. Ian Smith Volume 42 Neuroimmunology (in preparation) Edited by M. Ian Phillips and Dwight E. Evans Volume 52 Receptor Molecular Biology (in preparation) Edited by Stuart C. Sealfon Volume 62 PCR in Neuroscience (in preparation) Edited by Gobinda Sarkar 1 Molecular Strategies for Identifying Processing Enzymes Nabil G. Seidah Introduction In the early 1960s it was proposed that polypeptide hormones are first synthe- sized as inactive precursors that require specific cleavage after pairs of basic residues (such as LysArg-, ArgArg-, LysLys-, and ArgLys-) in order to release the active hormone. Since then this model has been extended to other precursors, as it is also applicable to progrowth factors, proneuro- trophic factors, hormonal receptors, adhesion molecules, retroviral surface glycoproteins, proenzymes, and even certain protoxins. The elaboration of the structures of many precursors as well as their biosynthetic products also revealed that processing C terminal to single basic residues such as Arg- (and less frequently Lys-) as well as after multiple basic residues (three or more) occurs in about 20% of the processed sites utilized in vivo. Therefore, it was of great interest to identify the proteinase(s) responsible for such proprotein processing and to define whether cleavage after monobasic resi- dues and C terminal to pairs of basic residues was performed by the same enzyme(s). The search for the physiologically important processing enzymes, termed "proprotein convertases" or "PCs," was laborious and a number of laboratories, including our own, participated actively in this hunt (1). The major breakthrough came in 1984, with the molecular identification of the convertase responsible for the activation of the yeast a-mating factor and killer toxin. The proteinase identified by genetic complementation of a KEX2 mutant strain was found to be a subtilisin-like serine proteinase (2, )3 and is now called "kexin." The search for the mammalian counterpart of kexin took about 5 years, before it was realized by computer database searches for sequence identity to kexin that a partial human genomic sequence encoding a protein called furin had already been reported by Roebroek et al. in 1986 (4). In the reported DNA sequence only the active site serine and the catalytically important asparagine residue found in all subtilisin-like proteases were identi- fied. The complete sequence of the 5' end of the gene was completed in 1989 and it comprised the other two active site residues, aspartate and histidine (5). Discovery of 1CP and PC2 Alignment of the amino acid sequences of furin and kexin within their cata- lytic domains revealed a number of segments exhibiting a high degree of Methods in Neurosciences, Volume 23 Copyright (cid:14)9 1995 by Academic Press, Inc. All rights of reproduction in any form reserved. 4 I MOLECULAR APPROACHES hFurin SGVTQRDLNVKAAWAQGYTGHGIVVSILDDGIEKNHPDLAGNYDPGASFD 174 (cid:12)9 Z .... J:ll" I "-'Jl I:l''J'llJ:: ~:'11 :J s :::lZl yKexin PSFPGSDINVLDLWYNNITGAGVV~~D_CzLDYENEDLKDNFCAEGSWD 196 hFurin VNDQDPDPEPRYTQMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGV 224 (cid:12)9 II.. I.II :.I: IIIIIIII:II .I..IIIII:III:I:I: yKexin FNDNTNLPKPR. . . LSDDYHGTRCAGE IAAKKGNNFCGVGVGYNAKI SG I 243 @ AS @ hFurin RMLDGEVTDAVDARSLGLNPNH I H I YSASWGPDDDGKTVHGPARLAE EAF 274 I'I.I-'I.. I: II .. (cid:12)9 .III.IIII.III-"II. I...I: yKexin RI LSGD I TTEDEAASL IYGLDVND IYS CSWGPADDGRHLQGPSDLVKKAL 293 II o~ hFurin FRGVSQGRGGLGS I FVWASGNGGREHDSCNCDGYTNS IYTLS I SSATQFG 324 (cid:12)9 :II.,II'-I.I'I'IIIIII I.II-IIIIIIII.:.I'..: (cid:12)9 yKexin VKGVTEGRDS KGAI YVFASGNGGTRGDNCNYDGYTNS I YS I T I GAI DHKD 343 (.-m I (.. hFurin NVPWYSEACSSTLATTYSSGNQNEKQ IVTTDLRQKCTESHTGTSASAPLA 374 I III'II..'I.IIIII .'. I ..I.'..'I.-II.IIII.IIII yKexin LHPPYSEGCSAVMAVTYSSG.. SGEYIHSSDINGRCSNSHGGTSAAAPLA 391 .GIF 1 Alignment of the amino acid sequences of human furin and yeast kexin within the catalytic domain. The active site residues Asp", His", and Ser a are emphasized, as well as the catalytically important Asn e. The sense )S( and antisense (AS) oligonu- cleotides used to identify human 2CP are shown, as well as the primers I( and II) that were first used to identify mouse 1CP and PC2.1, Identical sequence; ,: highly similar ni sequence. sequence identity (Fig. .)1 In 1989, the partial sequence of furin (from the catalytically important Asn* up to the C terminus) )4( and the full sequence ofkexin )3( were known. Accordingly, on the basis of the concept of sequence conservation around the active sites of serine proteinases, polymerase chain reaction (PCR) amplification of mRNA (reverse transcriptase-PCR or RT- PCR) allowed two laboratories simultaneously to isolate for the first time other mammalian homologs of kexin, known as PC1 (6, )7 and PC2 (6, 8), representing the first endocrine and neuroendocrine processing enzymes molecularly characterized in mammalian tissues. Polymerase chain reaction amplification of a cDNA synthesized from human insulinoma total RNA, using degenerate oligonucleotides encoding the consensus sequence sur- rounding the active site residues Asp" (oligo S; Fig. )1 and His" (oligo AS; Fig. )1 in kexin and related subtilisins, gave a 150-bp probe. The latter was used to screen a human insulinoma library and to isolate a full-length cDNA encoding a novel convertase called PC2 (8). Independently, PCR applied to cDNA obtained from mouse pituitary total RNA using oligonucleotides encoding the sequence around the catalytically important Asn* and the active site Ser u of human furin (oligos I and II, Fig. ,)1 allowed the isolation of a 260-bp probe (6, 7). Screening mouse pituitary and mouse insulinoma libraries

