Logout succeed
Logout succeed. See you again!
Ordinary Differential Equations PDF
Preview Ordinary Differential Equations
ORDINARY DIFFERENTIAL EQUATIONS Sze-Bi Hsu ii Contents 1 INTRODUCTION 1 1.1 Introduction: Where ODE comes from . . . . . . . . . . . . . . . . . 1 2 FUNDAMENTAL THEORY 9 2.1 Introduction and Preliminary . . . . . . . . . . . . . . . . . . . . . . 9 2.2 Local Existence and Uniqueness of Solutions of I.V.P. . . . . . . . . 11 2.3 Continuation of Solutions . . . . . . . . . . . . . . . . . . . . . . . . 19 2.4 Continuous Dependence on Parameters and Initial Conditions . . . . 21 2.5 Differentiability of Initial Conditions and Parameters . . . . . . . . . 24 2.6 Differential Inequality . . . . . . . . . . . . . . . . . . . . . . . . . . 26 3 LINEAR SYSTEMS 35 3.1 Introduction . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 35 3.2 Fundamental Matrices . . . . . . . . . . . . . . . . . . . . . . . . . . 36 3.3 Linear Systems with Constant Coefficients . . . . . . . . . . . . . . . 39 3.4 Two Dimensional Linear Autonomous system . . . . . . . . . . . . . 46 3.5 Linear Systems with Periodic Coefficients . . . . . . . . . . . . . . . 50 3.6 Adjoint System . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 56 4 STABILITY OF NONLINEAR SYSTEMS 65 4.1 Definitions. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 65 4.2 Linearization . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 66 4.3 Saddle Point Property: Stable and unstable manifolds . . . . . . . . 73 4.4 Orbital Stability . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 82 4.5 Travelling Wave Solutions . . . . . . . . . . . . . . . . . . . . . . . . 88 5 METHOD OF LYAPUNOV 99 5.1 An Introduction to Dynamical System . . . . . . . . . . . . . . . . . 99 5.2 Lyapunov Functions . . . . . . . . . . . . . . . . . . . . . . . . . . . 105 6 TWO DIMENSIONAL SYSTEMS 117 6.1 Poincare´-Bendixson Theorem . . . . . . . . . . . . . . . . . . . . . . 117 6.2 Levinson-Smith Theorem . . . . . . . . . . . . . . . . . . . . . . . . 125 6.3 Hopf Bifurcation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 132 7 SECOND ORDER LINEAR EQUATIONS 145 7.1 Sturm’s Comparison Theorem and Sturm-Liouville boundary value problem . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 145 7.2 Distributions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 151 7.3 Green’s function . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 153 7.4 Fredholm Alternative for 2nd order linear equations . . . . . . . . . 158 iii iv CONTENTS 8 THE INDEX THEORY AND BROUWER DEGREE 163 8.1 Index Theory In The Plane . . . . . . . . . . . . . . . . . . . . . . . 163 8.2 Brief introduction to Brouwer degree in Rn . . . . . . . . . . . . . . 170 9 INTRODUCTION TO REGULAR AND SINGULAR PERTUR- BATION METHODS 177 9.1 Regular Perturbation Methods . . . . . . . . . . . . . . . . . . . . . 177 9.2 Singular Perturbations : Boundary Value Problems . . . . . . . . . . 182 9.3 Singular Perturbation : Initial Value Problem . . . . . . . . . . . . . 187 Chapter 1 INTRODUCTION 1.1 Introduction: Where ODE comes from Thetheoryofordinarydifferentialequationsisdealingwiththelargetimebehavior of the solution x(t,x ) of the initial value problem I.V.P of first order system of 0 differential equations: dx 1 =f (t,x ,x ,···,x ) dt 1 1 2 n . . . dx n =f (t,x ,x ,···,x ) dt n 1 2 n x (0)=x , i=1,2···n i i0 or in vector notation dx = f(t,x), f :D ⊆R×Rn −→Rn, D ⊆R×Rn is open , dt (1.1) x(0) = x 0 where x=(x ,···x ), f =(f ,···,f ) 1 n 1 n If the right hand side of (1.1) is independent of time t , i.e. dx =f(x). (1.2) dt Then we say (1.1) is an autonomous system. In this case, we call f is a vector field on its domain. If the right hand side depends on time t, we say (1.1) is a nonautonomoussystem. Themostimportantnonautonomoussystemistheperiodic system i.e., f(t,x) satisfies f(t+w,x)=f(t,x) for some w > 0 (w is the period). If f(t,x) = A(t)x where A(t) ∈ Rn×n, then we say dx =A(t)x. (1.3) dt 1 2 CHAPTER 1. INTRODUCTION is a linear system of differential equations. It is easy to verify that if ϕ(t),ψ(t) are solutions of (1.3), then αϕ(t)+βψ(t) is also a solution of linear system (1.3) for α,β ∈R. The system dx =A(t)x+g(t) (1.4) dt is called linear system with nonhomogeneous part g(t). If A(t)≡A, then dx =Ax (1.5) dt is a linear system with constant coefficients. A system (1.1) which is not linear is called a nonlinear system. Usually it is much harder to analyze nonlinear systems than the linear ones. The essential difference is that linear systems can be broken downintoparts. Throughsuperpositionprinciple,Laplacetransform,Fourieranal- ysis,wefindalinearsystemispreciselyequalstothesumofitsparts. Butnonlinear systems which phenomena is almost our everyday life, does not have superposition principle. Inthefollowingwepresentsomeimportantexamplesofdifferentialequa- tions from Physics, Chemistry and Biology. Example 1.1.1 mx¨+cx˙ +kx=0 This describes the motion of a spring with damping and restoring force. Apply Newton’s law, F =ma, we have ma=mx¨=F =−cx˙ −kx= Friction + restoring force. Let y =x˙. Then (cid:189) x˙ =y y˙ =−cy− kx m m Example 1.1.2 mx¨+cx˙ +kx=F coswt. Then we have (cid:181) (cid:182) (cid:181) (cid:182) x˙ y = y˙ cy− kx+F coswt m m (cid:112) If c=0 and w = k/m, then we have ”resonance”. Example 1.1.3 Electrical Networks Let Q(t) be the charge on the capacitor at time t. Use the following Kirchoff’s 2nd law: In a closed circuit, the impressed voltage equals the sum of the voltage drops in the rest of the circuit. 1.1. INTRODUCTION: WHERE ODE COMES FROM 3 Fig.1.1 1. The voltage drop across a resistance of R ohms equals RI (Ohm’s law) 2. The voltage drop across an inductance of L henrys equals LdI dt 3. The voltage drop across a capacitance C farads equals Q/C Hence dI Q E(t)=L +RI + dt C Since I(t)= dQ, it follows that dt d2Q dQ 1 L +R + Q=E(t) dt2 dt C Example 1.1.4 Van der Pol Oscillator [K] p.481, [HK] p.172 u(cid:48)(cid:48) +(cid:178)u(cid:48)(u2−1)+u=0, 0<(cid:178)(cid:191)1 Let E(t)= u(cid:48)2 + u2 be the energy. Then 2 2 E(cid:48)(t) = u(cid:48)u(cid:48)(cid:48) +uu(cid:48) =u(cid:48)(−(cid:178)u(cid:48)(u2−1)−u)+uu(cid:48) (cid:189) = −(cid:178)(u(cid:48))2(u2−1)= <0, |u|>1 >0, |u|<1 Hence the oscillator is “self-excited”. Example 1.1.5 Van der Pol Oscillator with periodic forcing u(cid:48)(cid:48) +(cid:178)u(cid:48)(u2−1)+u=Acoswt The is the equation Cartwright, Littlewood, Levinson studied in 1940-1950 and Smale constructed Smale’s horseshoe in 1960. It is one of the model equations in chaotic dynamics. 4 CHAPTER 1. INTRODUCTION Example 1.1.6 Second order conservative system x¨+g(x)=0 or equivalently x˙ =x 1 2 x˙ =−g(x ) 2 1 (cid:82) The energy E(x ,x )= 1x2+V(x ), V(x )= x1g(s)ds satisfies 1 2 2 2 1 1 0 d E =0 dt Example 1.1.7 Duffing’s equation x¨+(x3−x)=0 The potential V(x)=−(1/2)x2+(1/4)x4 is a double-well potential. Fig.1.2 Example 1.1.8 Duffing’s equation with damping and periodic forcing. x¨+βx˙ +(x3−x)=Acoswt This is also a typical model equation in chaotic dynamcis. Example 1.1.9 Simple pendulum equation d2θ g + sinθ =0 dt2 (cid:96) 1.1. INTRODUCTION: WHERE ODE COMES FROM 5 Fig.1.3 F = ma d2θ −mgsinθ = m(cid:96)· dt2 Example 1.1.10 Lorentz equation [S] p.301, [V] 1. x˙ =σ(y−x) 2. y˙ =rx−y−xz σ,r,b>0 3. z˙ =xy−bz When σ = 10, b = 8, r = 28, (x(0),y(0),z(0)) ≈ (0,0,0), we have butterfly 3 phenomenon. Example 1.1.11 Michaelis-Menten Enzyme Kinetics ([K] p.511),([LS] p.302) Consider the conversion of a chemical substrate S to a product P by enzyme catal- ysis. The reaction scheme E+S (cid:42)(cid:41)k1 ES →k2 E+P k−1 was proposed by Michaelis and Menten in 1913. By the law of Mass action. We have the follows equations d[E]=−k [E][S]+k [ES]+k [ES] dt 1 −1 2 d[S]=−k [E][S]+k [ES] dt 1 −1 d[ES]=k [E][S]−k [ES]−k [ES] dt 1 −1 2 d[P]=k [ES] dt 2 6 CHAPTER 1. INTRODUCTION subject to initial concentration [E](0)=E , [S](0)=S , [ES](0)=[P](0)=0. 0 0 Since d d [ES]+ [E]=0 dt dt Hence [ES]+[E]≡E 0 Let (cid:193) (cid:193) 1. u=[ES] C , v =[S] S , τ =k E t 0 0 1 0 (cid:193) (cid:177) (cid:177) 2. κ=(k +k ) k S , (cid:178)=C S , λ= k−1 , C =E 1+κ −1 2 1 0 0 0 k−1+k+2 0 0 Then we have the equation of singular perturation du (v+κ)u (cid:178) =v− , 0<(cid:178)(cid:191)1 dτ 1+κ (cid:193) dv =−v+(v+κλ)u (1+κ) dt u(0)=0, v(0)=1 We shall study this example in chapter 9. Example 1.1.12 Belousov-Zhabotinskii Reaction [M] dx (cid:178) = qy−xy+x(1−x) dt dy δ = −qy−xy+2fz dt dz = x−z dt where (cid:178),δ,q are small, f ≈0.5. This is an important oscillator in chemistry. Example 1.1.13 Logistic equation. Let x(t) be the population of a species. (cid:179) (cid:180) dx x = rx−bx2 =rx 1− dt K K = carrying capacity Example 1.1.14 The Lotka-Volterra model for Predator-Prey interaction. Let x(t),y(t) be the population of prey and predator at time t respectively. ([M],p.124 and p.62). Then we have dx =ax−bxy dt a,b,c,d>0 dy =cxy−dy dt or dx =rx(1− x)−bxy dt k dy =cxy−dy dt

