Logout succeed
Logout succeed. See you again!

NASA Technical Reports Server (NTRS) 20030003730: A Tool for Low Noise Procedures Design and Community Noise Impact Assessment: The Rotorcraft Noise Model (RNM) PDF
Preview NASA Technical Reports Server (NTRS) 20030003730: A Tool for Low Noise Procedures Design and Community Noise Impact Assessment: The Rotorcraft Noise Model (RNM)
A Tool for Low Noise Procedures Design and Community Noise Impact Assessment: The Rotorcraft Noise Model (RNM) David A. Conner [email protected] Aerospace Engineer Aeroflightdynamics Directorate (AMRDEC), U.S. Army Aviation and Missile Command Hampton, Virginia, U.S.A. and Juliet A. Page [email protected] Senior Acoustical Engineer Wyle Laboratories Arlington, Virginia, U.S.A. Abstract To improve aircraft noise impact modeling capabilities and to provide a tool to aid in the development of low noise terminal area operations for rotorcraft and tiltxotors, the Rotorcraft Noise Model (RNM) was developed by the NASA Langley Research Center and Wyle Laboratories. RNM is a simulation program that predicts how sound will propagate through the atmosphere and accumulate at receiver locations located on flat ground or varying terrain, for single and multiple vehicle flight operations. At the core of RNM are the vehicle noise sources, input as sound hemispheres. As the vehicle _flies" along its prescribed flight trajectory, the source sound propagation is simulated and accumulated at the receiver locations (single points of interest or multiple grid points) in a systematic time-based manner. These sound signals atthe receiver locations may then be analyzed to obtain single event footprints, integrated noise contours, time histories, or numerous other features. RNM may also be used to generate spectral time history data over a ground mesh for the creation of single event sound animation videos. Acoustic properties of the noise source(s) are defined in terms of sound hemispheres that may be obtained from theoretical predictions, wind tunnel experimental results, flight test measurements, or a combination of the three. The sound hemispheres may contain broadband data (source levels as a function of one-third octave band) and pure-tone data (in the form of specific frequency sound pressure levels and phase). A PC executable version of RNM is publicly available and has been adopted by a number of organizations for Environmental Impact Assessment studies of rotorcraft noise. This paper provides a review of the required input data, the theoretical framework of RNM's propagation model and the output results. Code validation results are provided from aNATO helicopter noise flight test as well as atiltrotor flight test program that used the RNM as atool to aid in the development of low noise approach profiles. Introduction The Rotorcraft Noise Model (RNM) is a computer program that simulates sound propagation To more accurately estimate the noise footprint through the atmosphere. As anoise source, rotorcraft for rotorcraft and tiltrotor operations, and to provide a and tiltrotors are more complex than fixed-wing tool to aid in the development of low noise terminal aircraft. Rotorcraft sources are three dimensional in area operations, Wyle Laboratories developed the nature and the directivity and spectral content vary Rotorcraft Noise Model 1(RNM) under contract to the with flight condition, namely flight speed and flight NASA Langley Research Center. The United States path angle. A single engine operating state parameter Navy has also provided funding for improvements to (a generalization not applicable to rotorcraft) typically the propagation algorithms, namely propagation over characterizes fixed wing noise emissions. At its core, varying terrain 2. RNM utilizes single or multiple sound hemispheres (broadband and pure tone with phase) for a given flight condition to define the three-dimensional vehicle spectral source characteristics. Presented at Heli Japan 2002, Tochigi, Japan, November 11-13, 2002. This paper is declared a RNM calculates the noise levels in a variety of work of the U.S. Government and is not subject to metrics at receiver positions on the ground either at copyright protection in the United States. points of interest or on a uniform grid. Rotorcraft T213-6-1 operatioanrsedefineadseithesringlfelighttrackosr focused output data. RNM is also capable of asmultipleflighttrackwsithvaryinvgehiclteypes outputting the results in a file format that can be andflightprofilesA.coustpicropertieosfthenoise imported into a Geographical Information System source(asr)edefineindtermsofeithebrroadbaonrd (GIS). The noise contours can then be overlaid to pure-towneithphasseounhdemisphearnedsmaybe scale on a background map, which is ideal for obtainefdromtheoreticparledictionwsi,ndtunnel performing noise abatement studies, airport and experimentatifolignh, ttestmeasuremeonrtsa vertiport noise impact evaluations and land-use combinatioofnthethree.RNMhasbeenrecently planning studies. Ground mesh time history data may expandteodincludaetmosphesroicunpdropagation be post processed into acoustic simulation animations, effectsovervaryingterraini,ncludinghillsand particularly useful for understanding propagation over mountainoreugsionsa,swellasregionosfvarying varying terrain. acousticimalpedanscuechascoastarelgionsT.he UnitedStateDsepartmeonfDt efensaendtheNorth AtlanticTreatOy rganizat(ioNnATOh)aveadopted Earth-Fixed Coordinat_ System RNM as the standardpredictiontool for EnvironmenItmalpactAssessmenotfsmilitary rotorcraofpterationnosise. Thispapeprresenthtsetheoreticfraalmewoorfk theRNMi,ncludintghedatainputp,ropagatiaonnd, dataoutpumtoduleRs.esulftrsomaNATOflighttest designetodvalidatteheRNMarepresentedIn. additiorne,sulatsrepresentferodmaNASA / Army / Bell Helicopter XV-15 tiltzotor flight test program that utilized RNM as a tool to aid in the development of low noise approach profiles. X Rotorcraft Noise Model Figure 1. RNM Single Flight Track Definition. The major computational and physical elements of the RNM are the sound propagation module and Figure 2 shows the organization of the major the input and output modules. RNM requires as modules that form the software package. The input, source noise hemispheres, vehicle flight track, _Process" blocks are dedicated to reading the input flight profile orientation and operating state. Vehicle file provided by the user, scanning rotorcraft noise operations are quantified along a set of user defined data files (in binary netCDF 5 format), loading the vectored flight tracks (Figure 1). The vehicle flight is ground elevation and impedance data if requested, simulated in a time based domain along a prescribed and computing several look-up tables. The core flight track and the sound is analytically propagated propagation algorithm is nested inside several loops through the at_nosphere to the specified receiver through the vehicle sources, trajectory points and locations. The propagation model assumes that the receptor locations. The final block calculates the acoustic ray paths are straight lines and that there is integrated metrics and writes the output in the form of no wind present. Program plans are to incorporate the tables, grid and time history files. The remainder of current state-of-the-art at_nospheric propagation this section provides an overview of the methodology for wind effects into RNM in the near computational modules presented in Figure 2. future. RNM currently accounts for spherical spreading, atmospheric absorption, ground reflection Input Data Module and attenuation, Doppler shifts and the difference in phase between the direct and reflected rays. The most RNM reads the input files, which define the recent upgrade to the RNM (version L3.0) allows for analysis grid, flight operations, source sound the prediction of noise over varying ground terrain hemispheres and analysis options, and performs using an implementation of the Geometrical Theory rudimentary error checking. The input module of Diffraction, which includes extensions for calls various routines, which interpolate and diffraction as developed by Rasmussen 3. Prior integrate flight tracks and profiles into a series of versions of RNM 4 permitted propagation over flat trajectory, orientation, and vehicle state points. terrain; applicable only where physical properties of Defined at each point are the coordinates (X, Y, Z) the surrounding area are not significant. RNM for the flight track in the EaJcth-fixed coordinate performs the acoustical at_nospheric propagation for a system, the rotorcraft speed, yaw angle, the angle of given vehicle and creates ground noise predictions, attack, roll angle, and tiltrotor nacelle angle. The detailed time history predictions and other research input text file contains computational parameters, T213-6-2 Start Process Process Terrain Grid/Receiver iiiiii Anotshoeurrfcoterhivsehicle? Another trajectory point? Another flight operation? Another receiver location? Figure 2. Major RNM modules. a description of the calculating grid or points of noise footprint. To this end research applications of interest, and definition of the flight trajectory, RNM typically involve manual construction of the including the rotorcraft operating conditions. The single flight track input file using a text editor. By input files are keyword structured with specific wrapping an optimizer around RNM, the code may be formatting requirements for each keyword. exercised by a host program with the objective of searching out a minimum noise footprint for a single Single operation input data. The single operation departure or arrival track. The single-tzack mode may input file format is designed for studying low noise also be used to create tJctree dimensional sound takeoff and landing profiles and evaluating multiple simulation videos in order for the viewer to gain a sound source propagation from a single vehicle. better understanding of the sound propagation characteristics, especially useful over regions of One single operation application of RNM is to varying terrain. Additional applications for the identify low noise takeoff and landing profiles by single-track mode input version of RNM are the creating and interpreting detailed information on the development of noise abatement profiles and T213-6-3 comparisoofnsounhdemisphedreesvelopuesding describing a different noise source, for each flight analyticmalodelfsli,ghttestacoustdicataandwind condition. A flight vehicle may be described with a tunnemleasurements. maximum of ten broadband and ten pure tone sound hemispheres, each located at different points on the Multiple operation input data. The multiple operation rotorcraft (i.e., engine, main rotor, tail rotor, main input file format is structured to model annual rotor / tail rotor wake interference sources, etc.). rotorcraft noise at an airport or vertiport. The details of the multiple operation format is consistent with the way flight data is logged and collected by personnel Starboard at such facilities and the way environmental impact statements are currently performed by the acoustics community. The vertiport application of RNM is the prediction of community noise impact contours for civilian and military operations. This application requires RNM to simulate all noise-generating activities that result from annual rotorcraft operations. Analyses of aircraft noise exposure and compatible Tail land uses around Department of Defense (DoD) facilities are normally accomplished using a group of Port computer programs collectively called NOISEMAP 6. The NOISEMAP suite of computer programs consists of BASEOPS 7,NOISEMAP, NMPLOT 8 and RNM. OveralISPk(dB): 90 94 98 102106 110 The BASEOPS program allows entry of runway coordinates, airfield information, vectored flight Figure 3. CH-146 Sound Hemisphere. tracks, flight profiles for each track and for each aircraft, numbers of events, run-up coordinates, run- up profiles, and run-up events. BASEOPS creates A sound hemisphere is stored in a packed binary and maintains input files for use with NOISEMAP file using Network Common Data Form 5(netCDF). and RNM. This data format is an abstract data type (ADT) with access to the data performed by a set of functions or Sound hemispheres. RNM has the capability to routines. NetCDF efficiently stores mad retrieves the accept either analytically or experimentally generated data, is self-describing, and is platform independent. sound hemispheres for multiple sources, both Raw binary files can be passed between computers broadband and pure tone with phase. The analytical over the network and accessed as long as netCDF data may be created using computational fluid functions and utilities are used. Included with the dynamics or other techniques and interfaced with RNM distribution is a utility program SPHERE, RNM via NetCDF 5 files. One-third octave band which creates a sound hemisphere spectral data file sound hemispheres may be created from experimental that may be displayed graphically in three dimensions flight test data using the Acoustic Repropagation using the commercially available software package, Technique 9 (ART2) that is included with the RNM Tecplot.l° distribution. RNM will perform the atmospheric propagation for up to ten independently defined sound Atmospheric module. The atmospheric profile sources for a given vehicle. Source level noise data (pressure, temperature, and humidity) may be user are defined on the surface of a sound hemisphere defined. The RNM default atmosphere is the U.S. (Figure 3) and contain one-third octave or pure-tone Standard Atmospheric Profile, 1976 H. The sound sound levels and phase. Points on the hemisphere axe speed is calculated directly from the temperature described in terms of a fixed radius and two spherical profile using the ideal gas law. The air absorption angles. coefficients are determined using methods described in American National Standards Institute (ANSI) The sound hemisphere contains either broadband S1.26-197812 based on the input humidity profile. or pure-tone noise data for a single aircraft flight Weighted averages of sound speed and air absorption condition. Each file contains a set of attributes coefficient are calculated at each altitude. The sound defining the quasi-steady flight condition, using three speed and the air absorption coefficients are tabulated independent variables: airspeed, flight path angle, and at 1,000-foot intervals and accessed without nacelle pylon angle (for tiltrotor). For conventional interpolation by the propagation module. helicopters, the nacelle pylon angle is 90 degrees. There may be multiple sound hemispheres, each T213-6-4 Core Algorithms as a function of time. The sound is summed at the receiver locations and binned according to arrival The propagation algorithms are contained in the time. The broadband and pure tones (with phase) are core module, which is nested inside several loops that tracked independently and combined, accounting for increment the vehicle source, the vehicle type, and the phase and coherence. Lastly, the requested integrated receiver locations. Receiver locations are described metrics are calculated and output. either as the location of specific points under the flight track or as a uniform grid of points, either on a When exercising RNM in multiple track mode, a flat ground or over a specified terrain. default maximum track point spacing of 2.0 seconds is used. Generally, a500-foot or coarser ground mesh The location of the vehicle origin in the Earth- is used for community environmental noise impact fixed coordinate system (X, Y, Z), the rotorcraft analysis. A maximum forward flight speed in the operating state (velocity, flight path angle, and nacelle vicinity of the airfield for a typical helicopter (120 tilt angle), as well as the vehicle orientation are user knots), yields a flight path spacing commensurate defined in terms of the input flight track and flight with this ground mesh resolution. If smaller time step profile. The vehicle orientation is defined in terms of flight path definition is required the single-track aflight path angle, heading angle, pitch, roll and yaw. analysis method should be used multiple times, and the ground noise contours added together. If RNM accepts the location of the aircraft defined specified in the single-tzack input, RNM will provide by a separate set of vectored ground tracks and flight to the computational module ahigher resolution flight profiles. Additionally, RNM, in single-tzack mode, trajectory. accepts athree dimensional integrated flight track and profile as input. A vectored ground track is defined In order to interpolate between user defined by a series of straight line and turn segments. A segment endpoints, RNM uses a kinematics departure track begins at the helipad and proceeds in relationship based on constant acceleration. A the direction of travel. The starting point is defined combination of straight and curved segments is when the vehicle lifts off the ground. An arrival track interpolated linearly and the vehicle location, is defined in a sequence opposite the actual direction orientation, and operating state calculated. The of flight. An arrival track is defined from the helipad interpolated flight trajectory is written to the main and proceeds as if the aircraft is flying away from the RNM output file. If video generation is enabled a airfield rather than towards the airfield. The aircraft separate synchronized trajectory file is also created. flight profile is defined in terms of aircraft altitude above the reference ground level, indicated airspeed, Geometry Module. The location and orientation of a yaw angle, angle of attack, roll angle, and pylon angle rotorcraft relative to the Earth-fixed coordinate as a function of the cumulative flight track reference system is specified in terms of a flight path-fixed ground distance. The cumulative flight track ground coordinate system and three Euler angles. The flight distance is a running index constructed in the same pat_-fixed coordinate system is tangent to the order as the ground track. One role of the flight integrated tJctree-dimensional flight trajectory. RNM trajectory module is to combine the ground track and gives the user the freedom to orient the rotorcraft flight profile into an integrated trajectory in the Earth- arbitrarily with respect to the flight path-fixed fixed coordinate system. The acoustical analysis coordinate system. When calculating the location of within RNM simulates motion in the true direction of the individual sound source hemispheres RNM travel. rigorously accounts for the position of the vehicle along the flight trajectory (X, Y, Z), the direction of Flight trajectory module. The flight track module is the flight trajectory, and a full complement of vehicle capable of handling point-to-point integrated 3-D orientation angles (roll, angles of attack and sideslip flight trajectories, or integrating vectored ground (yaw)) in addition to the individual source location flight tracks and separate profiles. In single-track relative to the vehicle-fixed coordinate system origin. mode either form of track definition may be utilized. For multiple operation analyses the vectored flight As the vehicle advances from point to point along track and separate flight profile definition must be the flight track, the primary Euler angles for each used. The flight track module calculates the vehicle sound hemisphere source are calculated in the Earth- location (X, Y, Z, in the Earth-fixed coordinate fixed coordinate system. The sound propagating in system, see Figure 1) and orientation (roll, angles of the direction of the receiver is obtained from the attack and sideslip (yaw), nacelle position) as well as location on the source hemisphere, intersected by a vehicle trajectory (heading, flight path angle, velocity, straight line between the source center and receiver. turn rate) in the earth fixed coordinate system. This is These spherical angles are the hemisphere azimuth passed directly to the propagation module, which and elevation, and are dependent on the location of constructs the sound spectra at each receiver position the source and the location of the receiver in the T213-6-5 earth-fixecdoordinatseystemandthe vehicle Aspread = Geometrical spherical spreading loss, (point orientation relative to the flight path-fixed coordinate source). system. This geometric implementation presently in RNM remains unchanged since RNM version 1.0. It Aa_n= ANSI/ISO atmospheric absorption.12 assumes a zero roll angle and makes small angle approximations for all angles except yaw and heading Agrd = Ground reflection and attenuation losses, when computing the sound hemisphere Euler angles caused by the ground and the resultant (in order to simplify the geometry and avoid iterative interaction between direct and reflected solvers). For small angles of roll and sideslip this acoustic rays. The ground surface is difference is minimal. This simplification will be characterized as a complex acoustic addressed in afuture version of RNM. impedance. The calculations are based on a study made by Chien and Soroka 14 and Hemisphere Selection. RNM performs a two Chesse115 with corrections noted by Daigle. 16 dimensional interpolation considering both airspeed The algorithm uses the Doppler shifted and flight path angle. Each RNM sound hemisphere frequencies that axe based on the speed of the represents constant airspeed flight conditions at a rotorcraft and direction of the rotorcraft given flight path angle for a fixed nacelle angle. relative to the receiver. RNM performs a prioritization of the available sound hemispheres utilizing a hierarchical search of nacelle Atopo= Topography attenuation caused by the angle, flight path angle and aircraft speed. At each reflection and absorption that occurs from point along the flight trajectory the source sound barriers formed by the terrain located characteristics are extracted from the hemisphere files between the source and the receiver. Within using a linear interpolation in the energy domain RNM, the topography propagation module (pressure squared) at the required airspeed, followed combines the ground reflection and by a second linear interpolation in the energy domain attenuation Agrd, and topographic attenuation on the vehicle flight path angle. These interpolation Atopo,as a single term. Echo effects as would procedures are utilized when sufficient hemisphere be found in deep canyons or from surfaces flight resolution is available 13. For vehicles with behind the receiver relative to the source are sparsely populated acoustic hemispheres flight not presently treated by RNM. conditions, the prior RNM methodology of selecting the closest matching flight condition available Awina= Wind attenuation or amplification, caused by hemisphere, without interpolation, is utilized. the wind profile that exists between the source and the receiver. Presently, RNM Propagation module. The propagation algorithms are does not account for winds; however, embodied within the core computational model loop, program plans are to incorporate the current which advances point by point through the flight state-of-the-art atmospheric propagation trajectory. For each point along the flight track, each methodology for wind effects in the near noise source characterizing the vehicle is propagated future. independently. RNM is a source time based model, which uses the flight track based source time directly, The RNM propagation model assumes that the "binning" sound at the receiver locations based on ray paths are straight lines and there is no wind arrival time. Only after the propagation has been present. Temperature gradients that occur in the completed are the receiver sounds interpolated onto a atmosphere are modeled using the weighted average uniform time mesh and summed. sound speed and air absorption coefficients calculated in the atmospheric module. Day-to-day variations in Propagation Physics. In general, sound levels at a the atmosphere, important when modeling community distance r from a source can be expressed as the sum noise, can be treated by performing multiple analyses of the source sound level, the spherical spreading of flight operations with varying atmospheric loss, the atmospheric absorption, ground reflection parameters and summing the results. The source term and attenuation with terrain, and the effects due to L(r0) is calculated by interpolating data from the wind. This may be written mathematically as: appropriately selected sound hemisphere(s) as described earlier. Spherical spreading, Aspread , is L(r) = L(r0) + Aspread+ Aatm+ Aga-d+ Awmd+ Atopo calculated by modeling the sound source as a point source with the total acoustic power spreading over a where: hemisphere having an area proportional to r. The sound energy reaching the receiver decreases at arate L(r0) = Free field loss-less sound level at a distance proportional to 1/r2,or at the well-known rate of 6 dB r0 from the source directed from the source per doubling of the separation distance between the to the receiver. sound source and the point of observation. T213-6-6 AtJnosphelroicssesAa_na,recalculatebdy 1. Twopointsfl:atterrain. multiplyinthgeslandt istancbeytheairabsorption 2. Threpeointsc,oncavuep:hilolrvalley. coefficientR. NMusesanaltitudeaveragaeir absorptioconefficiecnatlculateindtheatmospheric3. Threpeointsc,onvedxo:wnhill. module. 4. Fouprointsw:edgoerscreewnithoneflat GroundreflectionandattenuatioAn_-da,re 5. Fivepointsw:edgoerscreewnithtwoflats. calculatebdyconsiderinthgepropagatioofnthe soundfield alonga boundarhyavingfinite Fla_ impedan1c4e.Theuserw,hoalsohastheoptionof selectinagprogramdefaulvtalue,providetshe _!phiilVt _IIOy) grounidmpedancTeh.esounfdieldhasbothadirect andareflecteradythatproductweowavefronttshat interactto produceeithersoundattenuatioonr amplificatioTnh.eexacotutcomoeftheinteractiiosn dependeonntthesourcaendreceivehreightt,he _i'liinScreen distancbeetweethnesounsdourcaendthereceiver, andtheimpedanocfethegrounpdlaneR. eturnteod thepropagatmioondualerethevalueisn,decibeflosr, theexcesgsrounadttenuation. TheRNMmethodolofogrygrounrdeflectioannd Figur4e.GeometTriecrraiCnlassifications. attenuatoiovnearreawsherteopograpfheicatureasre significainsttwofoldF:irstt,heeffectosfterraiannd Figure4 containtsheclassificatiofnosrthe receivearltituderelativetovehiclelocation(slant varioutserraimnodelsO.nlytheterraienitheirnthe rangea)recomputeSd.econtdh,eeffectosfterrainlineofsighotrthebrokelnineofsighitsconsidered. andgroundcoveron groundreflectionand Theshieldinaglgorithmtrasnsitiocnontinuoufsrolym attenuatdiounetothemultiplreaypathasrecomputedaPiercweedgteoaMaekawsacreenT.heeffecotf withRasmusseanlg'sorith3m.sThesealgorithmsterrainonthesounpdropagatiiosnthenapplietdo accounfotr shieldin(gmodeleadswedgesa)nd eachone-t_ird-octbaavnedinturnforeachsource structure(smodeledas thin screensm),ultipleandreceiveprointalongtheflighttrajectoryW.hen reflectioinnsvalleytsh,eeffectosfgrounimd pedanceterraiinsflat,Rasmusseanlg'sorithmresducteothe anddiffraction. flatearthgrounadttenuatimonodedlescribeedarlier inthissection. Rasmusstehne'soreticmaoldefolrthecalculation ofsounpdropagatoiovnevraryintgerraiinsbaseodn Superposition of Sound. RNM is capable of theGeometriTchael oroyfDiffractio(nGTD)R. NM analyzing multiple broadband and pure tone sound containtsheextensionosf theGTDto finite hemispheres on one vehicle. For a given noise impedantceerrainb,ymeanosfformulawehichare source, the arrival time is calculated based on a _not mathematicarlliygorousbut physically straight line propagation path from the sound plausib''3le. Theeffectsofwindandtemperature hemisphere center to the receiver using the local gradienatsrenotincludeindthecurrentotpography speed of sound at the vehicle. For computational model.Thesounfdieldatareceiveprointcanbe efficiency, the vehicle center is used for broadband describaesdthesumofdirecrte,flecteadnddiffracted arrival time since phase is not a concern with waves.Kelle1r7originallyintroducethdeGTD. broadband (incoherent) noise signals. This imparts Rasmussbeynh,ypothesdiesv,elopaetdechniqfuoer the assumption that the distance between multiple predictindgiffractewdavesa,sdeterminbeydlocal broadband sound hemispheres is small compared with geometbreytweethnesourcaendreceiverA.series the propagation path length. For pure tone (coherent ofapproximsaotelutionbsaseudpontheassumption noise source) propagation the phasing between thatthedistanceasrelongwithrespecttothe multiple hemispheres and any slight difference in wavelengwtherecategorizaenddimplemenftoerd propagation path length is critical. In addition, there severgaelometcriocnfigurations. are potential phasing differences from one source hemisphere and trajectory point to another that must RNMperformasgeometr_icsliceth' rougthhe be considered. RNM sequences the source signals in threedimensiontearlrainfromthesourcteothe terms of absolute phase. The source hemispheres are receivelorcationa,ndusinga numericafitlting referenced from the first time point in the flight techniqculeassifiethseprincipafelatureinstooneof trajectory. This sequencing is necessary to ensure thefollowinggeometmricodels: proper phase alignment between multiple source hemispheres as required by the varying operational T213-6-7 conditionTs.heresultapnhtasoefagivensignaalt data were acquired by orgmaizations from the U.S. thereceiveprointisasumoftheoriginadlefined (NASA Langley Research Center and Wright sourcehemispheprheaseplusthephasechange Patterson Air Force Base (AFB)), the U.K. (Royal Air betweethnebeginninogftheflighttrackandthe Force and Defense Evaluation and Research Agency), vehicleflighttracklocatio(ntime)fromwhichthe Germany, Norway, and Denmark. Wright Patterson puretonehemisphiesrperopagateTdh.epropagation AFB personnel deployed alinear microphone array to modulheandleasnyphascehangedsuetodifferent acquire the acoustic data that were used to generate propagatiopnathlengthsfromthe puretone noise hemispheres for RNM predictions. NASA hemisphceerentetrosthereceivleorcationF.orbook Langley personnel deployed a 30-microphone array keepinpgurposaensdsummati(oinncoherenwtliyth) over ma area 4000 feet long by approximately 3500 broadbannodiseth,earrivatlimeisconsiderteodbe feet wide area to simultaneously measure the noise theabsoluttiemeatwhichasignatrlavelfsromthe footprint. vehicloerigintothereceivelorcationT.hecoherent signaladditionis performeudsingthe fully Type of I Description of Output synchronipzehdasferomthestarotftheflighttrackin Receiver I orderto capturetheconstructive / destructive GRAPHICAL OUTPUT interference patterns for each pure tone frequency. Grid of Noise Footprints At Each Turn Point Single Receivers SPL, SPL(A), PNLT Track Grid of Noise Contours -SEL, SEL(C), Output Data Modules Format Receivers SEL(A), Lm_(A), EPNL RNM can output cumulative sound exposure Points of Time History Plot -Overall SPL, using avariety of measures. These are shown in Table Interest SPL(A), PNLT 1. RNM is capable of presenting the time history of a TABULATED OUTPUT noise event at a single observer position, the noise Points of Time History Tabulated -Lm_(A), footprint on the ground at a given time, or the noise Interest SEL, SEL(C), SEL(A), EPNL contours for many different noise metrics. The output Points of Table of Levels -Overall SPL, results are in a file format that can be imported into a Interest SPL(C), SPL(A), PNL, PNLT Geographical Information System (GIS). The noise GRAPHICAL OUTPUT contours may then be overlaid to scale on a Grid of Noise Exposure Contours -DNL, background map. This is the ideal process for Multiple Receivers CNEL, NEF, WECPNL Track performing noise abatement studies, evaluating noise Points of Time History Plot -Overall SPL, Format impacts at airports and vertiports, and performing Interest SPL(A), PNLT land-use noise studies. All RNM graphical output is TABULATED OUTPUT in the form of ASCII and binary grid files that are Points of Ranked Events -SEL(A), Lm_(A), ready for importing directly into TECPLOT 1° and Interest Rnm_ NMPLOT 8,respectively, for graphical display. Points of Table of Levels -DNL, Leq, Leq(C), Interest Leq(A), Lm_(A) RNM outputs the sound levels at specific points Table 1. RNM Output Metrics of interest. Contained within the RNM main text output file will be an ASCII art graphic of the time A comparison of measured and RNM predicted history at the points of interest. The time history of Sound Exposure Level (SEL) noise footprints for a 6° the overall SPL, the A-weighted SPL, and the PNLT approach at 103 knots is shown in Figure 5. RNM are written in TECPLOT format to maASCII file. For was run in single-txack mode using measured GPS multiple track analyses a rmaked specific point output position information for the RNM flight track input format is generated by RNM, which permits rapid data, and with all Euler angles set to zero because roll, identification of critical noise contributing flights. pitch and yaw were not measured on the test vehicle. The flow resistance parameter (expresses the ground NATO Flight Test specific acoustic impedance) was set to 300 cgs Rayls, which is typical for soil, and RNM was forced NATO/CCMS (Committee on the Current to use only the noise hemisphere that was acquired Challenges of Modern Society) Helicopter Noise simultaneously with the measured noise footprint. Trials were conducted at Canadian Forces Base The helicopter traveled from left to right in the figure, (CFB) Moose Jaw, Saskatchewan, Canada, in June with the flight path nominally along a line at Y = 0, 1998. The primary purposes for the test were to descending along a 6° glideslope that passed through develop an international standard for measuring and X = 0 at an altitude of approximately 470 feet. The analyzing the noise directivity characteristics of circles in Figure 5a indicate the actual microphone helicopters 18mad to acquire a database to validate the locations while the red-filled circles indicate RNM 19. The test vehicle was aBell 412SP (Canadian malfunctioning microphones that were not used in the military designation CH-146 "Griffon"). Acoustic generation of the noise footprint. The predicted noise T213-6-8 footprinhtasa250footgridresolutioinnbothXand SEL, dB _:__J..l.l......... Y. Thisfigureshowesxcelleangtreemebnettween 84 86 88 90 92 94 96 98 100 themeasuraenddpredictendoisefootprindtsirectly beneatthhevehicleandto thesidelineonthe 1500[- ...... retreatinsigdeofthevehicl(e+Y).Ontheadvancing side(-Y),RNMhasover-predicthteendoisleevebly 1000 I asmucahs3SELd,B.Thisisbelievetodresufltrom extrapolatdeadtainthesourcseounhdemisphere•. 500_ The currenttechniquefor obtainingsource_" o .............. hemisphe(AreRsT2r9e)quireassynchronizsetedady- stateflightoveramicrophomneeasuremaernraty. Themeasurdeadtaisthenre-propagabtaecdktoa -1000 .........................:.:.:.:.:.:.:.:.::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::_i_::.::_i fixedradiushemisphecreentereodnthevehicle, therebdyefininthgethree-dimenssiopneacltrsaolurce -1500 characteristTichse.lateraelxtenotfthemicrophone arrayfor validatintghepropagatio(Fnigure5a) -2000 extendbeedyontdhewidthofthemicrophoanreray usedtogenerattheesourcheemisphereres,ultining a) Measured footprint. theuseofdatafromanextrapolarteedgiononthe sourcheemispherFeo•rapproacflhightconditions Flight direction theextrapolarteegdiotnendtsowardthsefrontofthe soundhemisphereT•hisis a purelygeometric 1500 phenomendounetothelocatioonfthevehiclweith respetcotthemeasuremmeincrtophoanreray. lOOO 500 Figure 6 provides a comparison of the predicted and measured A-weighted overall sound pressure _ level (LA) time-histories on the flight path centerline, ;_ at the point (-2000,0) in Figure 5. Excellent -50(I agreement is shown between the measured and predicted LA between approximately 10 seconds and -1000 35 seconds• RNM is over-predicting the levels for times less than 10 seconds (out in front of the -1500 helicopter near the rotor tip-path-plane) and for times -2000 greater t]ama 35 seconds (to the rear of the helicopter -2000 =1000 0 1000 2000 near the rotor tip-path-plane). Again, this is believed X, ft. to result from the use of extrapolated data in the b) RNM predicted footprint. source sound hemisphere, predominately near the rotor tip-pat]a-plane, due to the location of the vehicle Figure 5. Bell 412SP Noise footprints; 6°approach at with respect to the measurement microphone array. 103 knots. However, these over-predictions will not significantly affect community noise impact predictions because 90 the integrated noise metrics used are dominated by audible signals within 10 dB of the maximum levels, 80 where very good agreement is shown in Figure 6. For situations where long-range propagation of noise emanating from the region near the rotor tip-pat]a- < plane is importmat, the experimental test setup and test procedures for measurement of the sound hemispheres are being refined to improve the source sound hemispheres by reducing the areas of 50 RNM t)redicted extrapolated data. Measured 40 : _ XV-15 Flight Test Program 3 , , , : , , , , , , , , : , , , , , , ., , , , i 10 20 30 4() 50 A series of three XV-15 acoustic flight tests were Time, Sec. conducted over afive-year period by aNASA / Army Bell Helicopter team. e° The purpose of the test Figure 6. Centerline microphone A-weighted overall program was to evaluate the noise reduction sound pressure level (LA) time-history comparison. T213-6-9 potentiafolrtiltzotoarircrafdturingterminaalrea increasing Levels operatiobnysalterintghenacellaengle / airspeed / altitude schedule. Lower hemispherical noise 3 dB Contour interval characteristics for a wide range of steady-state terminal area type operating conditions were measured during the phase 1 test and indicated that the takeoff and level flight conditions were not significant contributors to the total noise of tiltrotor operations] 1 Noise hemispheres measured during the ?J ¥,ft. 0 phase 1 test were then used with RNM to aid in the design of low noise approach profiles that were tested during the phase 2 and phase 3tests, which used large a) Measured 6°_baseline" approach. area microphone arrays to directly measure the ground noise footprints. Approach profile designs 2k emphasized noise reduction while maintaining handling qualities sufficient for tiltrotor commercial passenger ride comfort and flight safety under •(,It. o Instrument Flight Rules (IFR) conditions. Results showed that significant noise reductions were lk achievable over much of the measurement area -lk[ through the modification of the approach profile. -2k b) Measured 3°to 9° segmented approach. Figure 7 shows measured and RNM predicted XV-15 noise footprints. Each footprint extends from 2k 1000 feet down-range to 8000 feet up-range of the landing point and spans up to 2000 feet to either side of the landing point, covering an area of more than 650 acres. The XV-15 approached from the left in the Y,ft. o figure, along aline at Y = 0, coming to an IGE hover -llkk at about 20 feet AGL over the hover pad located at (0,0). The maximum SEL is not located about the -2k hover pad due to a combination of the microphone -Sk -7k -6k -5k -4k -3k =2k -lk 0 lk distribution around the hover pad and the linear X, ft. interpolation technique between the measurement c) RNM predicted 3°to 9° segmented approach. locations used by the graphics software. Safety concerns, as well as rotor-downwash-generated wind Figure 7. XV-15 ground noise footprints. noise, precluded locating a microphone on the hover pad. Figure 7a shows the footprint for a standard 6° Concluding Remarks approach profile. Significant noise reductions can be seen by comparing the noise footprint for a noise The Rotorcraft Noise Model (RNM) has been abatement 3° to 9° segmented approach profile developed by the NASA Langley Research Center (Figure 7b) to that for the standard 6° approach and Wyle Laboratories to estimate the noise footprint profile. Figure 7c shows the RNM predicted noise for rotorcraft and tiltrotor operations, and to provide a footprint for the same 3° to 9° approach profile tool to aid in the development of low noise terminal presented in Figure 7b. RNM was again run in the area operations. RNM requires source noise single-track mode using measured GPS position hemispheres for the vehicle of interest, operating information for the RNM flight track input data, and conditions and flight trajectory information as input all Euler angles were set to zero. The flow resistance data. Output options include atime history of anoise parameter was set to 1000 cgs Rayls because the soil event at a single observer position, the noise footprint was very dry and hard. The grid resolution was set to on the ground at a given instance in time, or noise 500 feet in X by 400 feet in Y. Very good agreement contours for many different noise metrics. RNM is can be seen between the measured and RNM also capable of outputting the results in a file format predicted noise footprints. It should be noted that the that can be imported into a Geographical Information source noise data used by RNM to predict the noise System (GIS) for land-use planning studies. RNM footprint of Figure 7c were obtained during Phase 1 has been recently enhanced to include the effects of testing while the measured noise footprint was sound propagation over varying terrain. RNM has obtained during Phase 2 testing that was conducted been validated in the audible frequency range using nearly two years later. data acquired during a number of different flight test programs. Additional experimentation of the T213-6-10