Logout succeed
Logout succeed. See you again!

Light spanners for snowflake metrics PDF
Preview Light spanners for snowflake metrics
Light spanners for Snowflake Metrics 1 Lee-Ad Gottlieb Shay Solomon 2 ∗ † 3 Abstract 44 Aclassic resultinthe study of spannersis the existence oflightlow-stretchspannersforEuclidean 15 spaces. Thesespannershavearbitrarylowstretch,andweightonlyaconstantfactorgreaterthanthat 06 oftheminimumspanningtreeofthepoints(withdependenceonthestretchandEuclideandimension). 2 7 A central open problem in this field asks whether other spaces admit low weight spanners as well – n8 for example metric space with low intrinsic dimension – yet only a handful of results of this type are a 9 known. J 10 Inthis paper,we considersnowflakemetric spacesoflowintrinsicdimension. The α-snowflakeofa 0 211 metric (X,δ) is the metric (X,δα), for 0<α<1. By utilizing an approach completely different than 12 thoseusedforEuclideanspaces,wedemonstratethatsnowflakemetricsadmitlightspanners. Further, ]13 we show that the spanner is of diameter O(logn), a result not possible for Euclidean spaces. As an G 14 immediate corollary to our spanner, we obtain dramatic improvements in algorithms for the traveling C15 salesman problem in this setting, achieving a polynomial-time approximationscheme with near-linear s.16 runtime. Along the way, we also show that all ℓp spaces admit light spanners, a result of interest in c17 its own right. [ 1 v 4 1 0 5 . 1 0 4 1 : v i X r a ∗Department of ComputerScience and Mathematics, Ariel University,Ariel, Israel. E-mail: [email protected]. †DepartmentofComputerScienceandAppliedMathematics, TheWeizmannInstituteofScience,Rehovot76100, Israel. E-mail: [email protected]. This work is supported bythe Koshland Center for basic Research. 1 Introduction 18 19 Given a complete graph G, a (1+ǫ)-spanner for G is a subgraph H G which preserves all pairwise ⊂ 20 distances in G to within a factor of 1 + ǫ. Low-stretch spanners with additional favorable properties 21 – such as low degree, weight or small hop diameter – have been the object of much study, in settings 22 such as Euclidean space, planar graph metrics, and metrics with low intrinsic dimension [AS97, AMS94, 23 ADM+95, ACC+96, CG06, GR08a, GR08b, DES08, Sol11, ES13]. 24 AspannerH issaidtobelight ifitsweightisproportionaltotheweightoftheminimumspanningtree 25 of G, w(MST(G)), and its lightness is the constant (or term) multiplying w(MST(G)). A major result 26 of the nineties is that d-dimensional Euclidean spaces admit light (1+ǫ)-spanners, with lightness ǫ−O(d) 27 [DHN93]. An importantresultin its own right, thelight Euclidean spanneris also acentral componentin 28 the fastest polynomial time approximation scheme (PTAS) for the Euclidean traveling salesman problem 29 (TSP): Using a light spanner, a (1+ǫ)-approximate tour can be computed in time 2ǫO(d)n+2O(d)nlogn 30 [Aro98, RS98]. 31 The existence proof for light Euclidean spanners is complex. At its core, it relies on the leapfrog 32 property specific to Euclidean space. It seems difficult to extend this proof to other natural spaces, and 33 in fact light spanners are known for only a handful of settings. These include planar graphs [ADD+93], 34 unit disk graphs [KPX08], and graphs of bounded pathwidth [GH12] and bounded genus [DHM10]. In 35 fact, a central conjecture in this area asks whether all metric spaces M with low intrinsic dimension 36 admit light (1+ǫ)-spanner. The best lightness bound known for spanners in these metrics is Ω(logn) 37 [Smi09, ES13]. 38 Inthispaperwetakeasteptowards thisconjecture, byshowingthatlightspannersexistforsnowflake 39 metricsoflowdoublingdimension;theα-snowflakeofametric(X,δ)isthemetric(X,δα),with0 < α< 1. 40 Snowflake metrics have been a focus of study in the recent literature [Ass83, GKL03, LMN04, ABN08, 41 GK11, BRS11, NN12, Nei13]. We will give two separate proofs for the existence of light spanners for 42 snowflake metrics. As an immediate corollary, we derive a fast approximation algorithm for TSP on 43 snowflake metrics, which yields a dramatic improvement on what was previously known [BGK12]. 44 The first proof, presented in Section 2, is based on a new observation: For any constant-dimensional 45 vector space V, the edges of a light (1+ǫ)-spanner for space (V,ℓ2) also form a light (1+ǫO(1))-spanner 46 for any space (V,ℓp), when p 1. This result is of independent interest, and also implies an efficient ≥ 47 approximation algorithm for traveling salesman in ℓp (see Corollary 4.3). Further, combining this result 48 with the fact that the α-snowflake of any metric M embeds with 1 + ǫ distortion into ǫ−O(ddim(M))- 49 dimensional ℓ [HPM06], we conclude in Theorem 2.5 that every snowflake metric M admits (1+ǫ)- 50 spanners of lig∞htness 2ǫ−O(ddim(M)). 51 Unsatisfied with the lightness bound provided by Theorem 2.5, we present a second proof in Section 52 3. This proof is more involved, but yields an exponentially better lightness bound. The proof considers 53 the standard net-tree spanner (NTS), and demonstrates that for snowflake metrics, the NTS is light. 54 In Theorem 3.7, we show that the NTS on a snowflake metric M has stretch (1 + ǫ) with lightness 55 ǫ−O(ddim(M)). The advantage of this spanner over that of Section 2 is threefold: (1) It bypasses the heavy 56 machinery of the leapfrog property and the use of low-distortion embeddings. (2) The dependencies 57 on ǫ and the doubling dimension in the lightness bound, as well as the leading constant therein, are 58 significantly smaller. This is of particular interest to practitioners in the field. (3) The NTS is the central 59 tool in several spanner constructions that combine small weight with other favorable properties, and the 60 weight bound in all these constructions depends on the weight of the NTS. Consequently, we improve the 61 weight bound in all these constructions (see Section 4). 62 An interesting property of our spanners is that they have logarithmic hop-diameter, a result not 63 possible for regular metric spaces. In fact, even 1-dimensional Euclidean space requires linear hop- 64 diameter for light spanners [DES08]. 65 The paper is organized as follows: We close this introductory section with preliminary notes and 66 definitions. We present the first proof in Section 2: We show that there exists a light spanner for all ℓp 1 67 spaces, and that this implies a light spanner for snowflake metrics as well. The second proof appears in 68 Section 3. Finally, wedetail somefurtherapplications ofour proofs,includingTSPalgorithms, inSection 69 4. 1.1 Preliminaries 70 71 Let (X,δ) be an arbitrary n-point metric. Without loss of generality, we assume that the minimum 72 inter-point distance of X is equal to 1. We denote by ∆ = maxu,v X δ(u,v) the diameter of X. ∈ 73 Doubling dimension. Thedoubling dimension of ametricspace(X,δ), denoted byddim(X)(or ddim 74 when the context is clear), is the smallest value ρ such that every ball in X can be covered by 2ρ balls 75 of half the radius. A metric is called doubling if its doubling dimension is bounded above by a constant 76 [GKL03]. 77 Hierarchical Nets. A set Y X is called an r-cover of X if for any point x X there is a point ⊆ ∈ 78 y Y, with δ(x,y) r. A set Y is an r-packing if for any pair of distinct points y,y′ Y, it holds that ∈ ≤ ∈ 79 δ(y,y′)> r. We say that a set Y X is an r-net for X if Y is both an r-cover of X and an r-packing. By ⊆ 80 recursively applying the definition of doubling dimension, we can derive the following key fact [GKL03]. 81 Fact 1.1. Let R 2r > 0 and let Y X be an r-packing in a ball of radius R. Then, Y (R)2ddim(X). ≥ ⊆ | | ≤ r 82 Write ℓ = ⌈log∆⌉, and let {Ni}ℓi 0 be a sequence of hierarchical nets, where N0 = X and for each 83 i [ℓ], Ni is a 2i-net for Ni 1. We ref≥er to Ni as the i-level net, and the points of Ni are called the i-level ∈ − 84 net-points. Note that N0 = X N1 ... Nℓ, and Nℓ contains exactly one point. The same point ⊇ ⊇ ⊇ 85 of X may have instances in many nets; specifically, an i-level net-point is necessarily a j-level net-point, 86 for every j [0,i]. When we wish to refer to a specific instance of a point p X, which is determined ∈ ∈ 87 uniquely by some level i [0,ℓ] (such that p Ni), we may denote it by the pair (p,i). ∈ ∈ 88 Net-tree Spanner. For each i [0,ℓ 1], cross edges are added between i-level net-points that are ∈ − 89 within distance γ 2i from each other, for some parameter γ = Θ(1). By Fact 1.1, for each i [0,ℓ], the · ǫ ∈ 90 degree of any net-point (p,i) in the net-tree spanner (due to i-level cross edges) is ǫ−O(ddim). 91 Let R be the sum of radii of all net-points, where the radius rad(p,i) of an i-level net-point (p,i) is 92 equal to 2i, disregarding the single net-point at level ℓ. It is easy to see that the weight of the net-tree 93 spanner is given by R γ ǫ−Θ(ddim) = R ǫ−Θ(ddim). However, as shown in Section 3.1, R may be as · · · 94 large as Θ(logn) ω(MST(X,δ)), even for 1-dimensional Euclidean metrics. Consequently, the net-tree · 95 spanner in doubling metrics has lightness Θ(logn) ǫ−Θ(ddim). On the other hand, it turns out that in · 96 snowflake doubling metrics – the net-tree spanner is light. 2 Proof via ℓ space 97 p 98 In this section we present our first proof that snowflake metrics admit light (1 + ǫ)-spanner. We will 99 first need to prove a certain property concerning Euclidean vectors (Section 2.1). We then show that 100 given a set of d-dimensional vectors S, the edges of a light (1+ǫ)-spanner for (S,ℓ2) also form a light 101 (1+ǫO(1))-spanner for all (S,ℓp) p 1, which itself implies a light spanner for snowflake metrics. ≥ 102 Before presenting the proof for ℓp spaces, we formally state the Euclidean light spanner theorem of 103 [DHN93]. For an edge set E, let wp(E) be the sum of the lengths of the edges under ℓp. Let MSTp(S) 104 be the edge set of the minimum spanning tree for S under ℓp. 105 Theorem 2.1. Let S be a d-dimensional point set of size n. Then there exists an edge set E which forms 106 a (1+ǫ)-spanner for S under ℓ2, with w2(E) = ǫ−O(d)w2(MST2(S)). 2 2.1 Properties of Euclidean vectors 107 108 In Section 2.2 we will require a property of Euclidean vectors detailed in Lemma 2.3 below. We begin 109 with the following simple fact: 110 Lemma 2.2. For 0 ≤ ǫ0 ≤ ǫ ≤ ǫ1, ǫ ≤ 14, and non-negative a,b, if ǫ1a+ǫ0b ≤ ǫ(a+b) then ǫ1a+√ǫ0b ≤ 111 √ǫ(a+b). 112 Proof: Rewriting both inequalities, we claim that (ǫ1 ǫ)a (ǫ ǫ0)b implies that (ǫ1 √ǫ)a − ≤ − − ≤ 113 (√ǫ √ǫ0)b. This claim is confirmed by dividing both sides of the first inequality by √ǫ +√ǫ0. The − 114 division immediately yields the right hand side of the second inequality; the left hand side follows by 115 noting that √ǫ+√ǫ0 ≤ 12 + 21 = 1, and then observing that √ǫǫ1+−√ǫǫ0 > ǫ1(√ǫ+√√ǫ0ǫ)+−√√ǫǫ0(√ǫ+√ǫ0) = ǫ1−√ǫ. 116 117 Lemma 2.3. Let V be a set of d-dimensional vectors. Given some vector w, let each vector vi V ∈ 118 be decomposed into two orthogonal vectors vi⊥,vik, where vi⊥ + vik = v and vi⊥ is orthogonal to w. For 119 0 < ǫ 1, if ≤ 4 v = (1+ǫ) v , 2 k 2 k k k k vXV vXV ∈ ∈ 120 then v (1+ǫ) v k 2 k 2 k k ≤ k k vXV vXV ∈ ∈ 121 and v 3(1+ǫ)√ǫ v . ⊥ 2 k 2 k k ≤ k k vXV vXV ∈ ∈ 122 Proof: The first part of the Lemma is trivial: Since the vectors are orthogonal, v V kvkk2 ≤ ∈ 123 v∈V qkvkk22+kv⊥k22 = v∈V kvk2 = (1+ǫ)k v∈V vkk2. P P P P 124 Moving to the second part, note that we may assume without loss of generality that all vk have the i 125 same length: We can always enforce this property by segmenting the vi’s into small vectors with equal 126 parallel contribution without violating the conditions of the lemma. 127 Define set A, where for each element ai ∈ A, ai = kkvvi⊥ikkk22. We have kvik2 = qkvikk22+kvi⊥k22 = 128 q1+a2ikvikk2. We wish to bound vi∈V kvi⊥k2 = vi∈V aikvikk2. Partition A into two subsets A0,A1 ⊂ 129 A, where A0 contains elements ofPvalue less than 1P, and A1 contains elements of value greater or equal 130 to 1. Likewise, partition V into two subsets V0,V1 V, where vi Vj if and only if ai Aj. We have ⊂ ∈ ∈ a vXi∈V1kvik2 = vXi∈V1q1+a2ikvikk2 > vXi∈V1(1+ 3i)kvikk2, a2 v = 1+a2 v > (1+ i ) v . vXi∈V0k ik2 vXi∈V0q ik kk2 vXi∈V0 3 k kk2 131 By the assumption of the lemma, (1+ǫ) v = v 132 kPv∈V kk2 >==≥ PPPPk vvvviiii∈∈∈∈viVVVV∈11Vkk(k1vvviik+iikkkkk2222a3++i+)kPPvikvvvkiii∈∈2∈VVV+101kaP3a3ivikikvkvvi2i∈kikkVk202(+1++Pav3v2iii∈∈)VkV0v0ikaa3k32i2i2kkvvikikkk22. P P P 3 111133336543 aPPnadviiT∈∈itVAh0me0afiau332i2inskta≤vlbikikeǫn2|teAhq≤|aut=aǫǫlki1ǫtP|y≥Vfv|o.1∈3lVlS>owevtiǫkskaPf2nr.odamRi∈ǫeA0tc1h≤aela3liǫt.tr=hiIaafnǫtw1g|elwVefie1i|xnmaetqnhaudyeatPaleistrsyamu.i∈mIǫAt0e0faoat3n2ihlldoa=wttasaǫk0lielm|Vtkm0hv|e,ikekdes2olieamtatehreleaynttetsqǫh1uoa|faVtlA1P,|0s+voai∈sǫPV0v1|aVarai30ii∈|akAb≤v1likeakǫ3,i|2wV++e| 113378 saenedtuhsaitngPLaei∈mAm0aai2a.t2tawineshiatvsemthaxatimum value when ai = √3ǫ0 for all ai ∈ A0. So Pai∈A0ai ≤ √3ǫ0|V0|, v∈V kv⊥k2 = vi∈V1aikvikk2+ vi∈V0aikvikk2 P ≤ P[3ǫ1|V1|+√3ǫ0|V0P|]kv0kk2 139 ≤ 3[ǫ1|V1|+√ǫ0|V0|]kv0kk2 ≤ 3√ǫ|V|kv0kk2 ≤ 3(1+ǫ)√ǫk vi∈V vikk2. P 140 2.2 Light ℓ and snowflake spanners 141 p 142 Here we will show that ℓp spaces – and therefore snowflake metrics – admit light spanners. Observe that 1 1 143 for any d-dimensional vector x, when p 2 we have x p x 2 d2−p x p, and when p 2 we have ≥ k k ≤ k k ≤ k k ≤ 1 1 144 d2−p x p x 2 x p. We can prove the following lemma: k k ≤ k k ≤ k k 145 Lemma 2.4. Let E be the edge set of a (1 + ǫ)-spanner for S under ℓ2, with weight w2(E) = c · 1 1 1 1 146 w2(MST2(S)) for some constant c := c(d,ǫ). Let d′ = max d2−p,dp−2 . Then set E forms a (1+ǫ)(1+ { } 147 3d′√ǫ)-spanner for S under ℓp, 1 p with weight wp(E) cd′ wp(MSTp(S)). ≤ ≤ ∞ ≤ · 148 Proof: We first prove the weight guarantee. Recall that MST2(S) is the minimum weight connected 149 graph under ℓ2. When p 2 we have ≥ w (E) w (E) p 2 ≤ = c w (MST (S)) 2 2 150 c·w (MST (S)) 2 p ≤ · 1 1 cd2−p wp(MSTp(S)). ≤ · 151 When p 2, we have ≤ 1 1 wp(E) dp−2 w2(E) ≤ · 1 1 = cdp−2 w2(MST2(S)) 152 1 1 · cdp−2 w2(MSTp(S)) ≤ · 1 1 cdp−2 wp(MSTp(S)). ≤ · 153 Thiscompletes theproofoflightness, andweproceedwiththestretch guarantee. Considerany vertex 154 pair x0,xt S, connected in E by the minimal (under ℓ2) edge path P0,t = (x0,x1),...,(xt 1,xt) . Let ∈ { − } 155 V be a set of vectors vi transitioning xi to xi+1, that is vi = xi+1 xi. We will employ Lemma 2.3 − 156 with respect to V and vector w = xt −x0. For parallel vectors, we have that PPvv∈∈VV kkvvkkkk2p = kkPPvv∈∈VV vvkkkkp2. 157 Since E is a (1+ǫ)-spanner, Lemma 2.3 gives v V kvkk2 ≤ (1+ǫ)k v V vkk2 and so v V kvkkp ≤ ∈ ∈ ∈ 158 (1+ǫ)k v V vkkp. Lemma 2.3 also gives v VPkv⊥k2 ≤ 3(1+ǫ)√ǫk Pv V vkk2: When pP≥ 2, we have ∈ ∈ ∈ 159 v V kvP⊥kp ≤ v V kv⊥k2 ≤ 3(1+ǫ)√ǫkP v V vkk2 ≤ 3d′(1+ǫ)√ǫPk v V vkkp, and when p < 2 we ∈ ∈ ∈ ∈ P P P P 4 160 have v V kv⊥kp ≤d′ v V kv⊥k2 ≤ 3d′(1+ǫ)√ǫk v V vkk2 ≤ 3d′(1+ǫ)√ǫk v V vkkp. We conclude 161 that P ∈ P ∈ P ∈ P ∈ wp(E) = ti=−01kvikp 162 ≤ Pti=−01[kvikkp +kvi⊥kp] P(1+ǫ) w p +(3d′(1+ǫ)√ǫ) w p ≤ k k k k = (1+ǫ)(1+3d√ǫ) w . ′ p k k 163 164 It follows that a (1 + ǫ)-spanner for (S,ℓp) with lightness ǫ−O˜(d) can be achieved by building a 165 (1+O((ǫ/d′)2))-spanner for (S,ℓ2) of lightness ǫ−O(d), as in Theorem 2.1. 166 Remark. Lemma 2.4 shows that the stretch guarantee of a Euclidean spanner holds even if the metric 167 is later changed to a different ℓp. While this claim is true for Euclidean spanners, it does not hold for 168 all ℓp spanners, for example ℓ : Consider three vectors v1 = (0,0), v2 = (1,1), v3 = (2,0), and the two ∞ 169 edges v1,v2 and v2,v3 . Then this spanner has no distortion for (S,ℓ ), but constant distortion for { } { } ∞ 170 (S,ℓp) and fixed p. 171 Given a metric M = (X,δ) with dimension ddim(M), the metric (X,δα) has doubling dimension 172 ddim(M) [GK11]. Har-Peled and Mendel [HPM06] demonstrated that 1-snowflake metrics embed into ℓ α 2 173 with low distortion and dimension, and their result can be extended to show that (X,δα) embeds int∞o 174 d-dimensional ℓ with distortion 1+ǫ and target dimension d = ǫ−O(ddim(M)/α) [GK11]. Together with 1 α 175 Theorem 2.1 an∞d Lemma 2.4, we may conclude: − 176 Theorem 2.5. Let M = (X,δ) be an n-point doubling metric with doubling dimension d. For any 177 0 < α< 1 and ǫ > 0, there exists a (1+ǫ)-spanner for (X,δα) with lightness 21−1αǫ−O˜(ddim(M)/α). 3 Direct snowflake proof 178 179 In this section we present a second, tighter proof for the existence of light spanners for snowflake metrics. 180 Let (X,δ) be an arbitrary n-point doubling metric, and let 0 < α < 1 be an arbitrary parameter. The 181 corresponding snowflake metric X˜ := (X,δα) is also doubling, with doubling dimension at most ddim(X). α 182 Denote by ∆˜ = maxu,v X δα(u,v) the diameter of X˜, and write ℓ˜= log∆˜ . Next we build the sequence 183 of hierarchical nets {N˜∈i}ℓi˜ 0 and the net-tree spanner for the snowfla⌈ke me⌉tric X˜; denote by R˜ the sum 184 of radii of all net-points, d≥isregarding the single net-point at level ℓ˜. 185 In what follows we prove that R˜ = O( 1 ) ω(MST(X˜), which implies that the lightness of the 1 α · 186 net-tree spanner for X˜ is ǫ−O(ddimα(X)) · 11α. W− e first give some intuition by considering a trivial metric 187 in Section 3.1. The proof of the general c−ase proceeds in two stages. 188 1. In the first stage (Section 3.2) we construct an auxiliary graph G˜ whose weight W˜ is Ω(R˜). The graph 189 G˜ willbegivenastheunionofℓ˜simplepaths,andisthusmoreamenabletoanalysisthanthestandard 190 net-tree spanner. The vertex set of this graph G˜ is equal to X. 191 2. In the second stage (Section 3.3) we show that W˜ = O( 1 ) ω(MST(X˜). 1 α · − 3.1 Intuition and High-Level Ideas 192 193 Beforedelvingintotheproof,itisinstructivetoconsiderthe1-dimensionalEuclideancase, andtorestrict 194 our attention to α = 1. The intuition behind the general proof is present even in this basic case. 2 195 Let ϑ = ϑn be a set of n points v1,...,vn lying on the x-axis with coordinates 1,...,n, respectively, 1 196 and consider the corresponding snowflake metric ϑ˜ = (ϑ,ℓ22). (See Figure 1 for an illustration.) Since 197 the diameter ∆˜ of ϑ˜ is √n 1, the number of levels in the underlying net-tree is given by ℓ˜= log∆˜ = − ⌈ ⌉ 198 1 log(n 1) . Also, the doubling property implies that the number of i-level net-points is proportional ⌈2 − ⌉ 5 ˜ ϑ 3 √3 2 √2 1 v v v v v v v v v v v v v v v v v 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 Figure 1: An illustration of the 1-dimensional Euclidean point set ϑ=ϑ ={v ,...,v }, and the corresponding snowflake 17 1 17 1 metric ϑ˜=(ϑ,ℓ2). Only 6 edges (out of the total (cid:0)17(cid:1) edges) are depicted in the figure, along with their weights which are set 2 2 1 1 according to thesnowflake distance function k·k2; thustheweight of edge (v1,v17), for example, is given by|17−1|2 =4. 199 to 2n2i. If R˜i stands for the sum of radii of all i-level net-points, then R˜i = O(2n2i)·2i = O(2ni), so R˜ = 200 iℓ˜=−01R˜i = iℓ˜=−01O(2ni)= O(n). Observe that ω(MST(ϑ˜)) = n−1. It follows that R˜ = O(ω(MST(ϑ˜))), 201 wPhich provePs the desired bound on the lightness.1 202 This argument is simple, but it is unclear how to generalize it for arbitrary snowflake metrics. We 203 next provide a more involved proof, whose intuition will be used in the general proof. 204 Supposeforsimplicityofthepresentationthatn 1isanintegerpowerof4. Foreachindexi [0,ℓ˜ 1], 205 we choose a subset Pi = v1,v1+22i,v1+222i,...,vn−of pivots from ϑ˜, where the ℓ2 distance be∈tween−any 206 two consecutive i-level p{ivots is exactly·22i. Since}N˜i is a 2i-packing, the ℓ2 distance between any pair 207 of i-level net-points is greater than 22i. Consequently, it is easy to see that the number Pi of i-level | | 208 pivots is greater than the number N˜i of i-level and net-points, i.e., Pi > N˜i . Let Πi be the simple | | | | | | 209 path connecting all points of Pi, i.e., Πi = (v1,v1+22i,v1+222i,...,vn). Notice that the weight of each 210 edge in Πi (under the snowflake distance function) is equal·to the radius 2i of i-level net-points. Since 211 |Pi| ≥ |N˜i|, the weight ω(Πi) of Πi is no smaller than R˜i. Let G˜ = iℓ˜=−01Πi be the union of the ℓ˜paths Π0,...,Πℓ˜ 1, and let W˜ = iℓ˜=−01ω(Πi) be the weight of G˜. ObserveSthat W˜ ≥ R˜. (See Figure 2.) We − P ˜ G 2 1 v v v v v v v v v v v v v v v v v 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 Figure 2: An illustration of G˜ = Π ∪Π , in the case that ϑ = {v ,...,v } and ℓ˜= 2. The path Π = (v ,v ,...,v ) 0 1 1 17 0 1 2 17 consists of16edgesofunitweightdepictedbysolid lines, andthepathΠ =(v ,v ,v ,v ,v )consists offouredgesofweight 1 1 5 9 13 17 2 depicted by dottedlines. The weight W˜ of G˜ is equal toω(Π )+ω(Π )=16+8=24. 0 1 221132 have thus reduced the problem of lower bounding R˜ to that of lower bounding W˜ . 214 Even though lower bounding W˜ for this basic 1-dimensional case can be done by a direct calculation, 215 our goal here is to present a method that can be applied in the general case. Any edge (v ,v ) of path Π = (v ,...,v ) will be called a path edge. We say that edge e = (v ,v ) l l+1 0 1 n j k (with 1 j < k n) loads a path edge (v ,v ) if j l < l+1 k. Thus edge (v ,v ) loads the k j l l+1 j k ≤ ≤ ≤ ≤ − 1 1 path edges (vj,vj+1),...,(vk−1,vk). Next we would like to distribute the weight kvj,vkk22 = |k−j|2 of edge e = (v ,v ) over all the path edges which it loads. Specifically, the load ξ (e) on path edge j k (vl,vl+1) (v ,v ) caused by edge e = (v ,v ) G˜, for j l < l+1 k, is defined as l l+1 j k ∈ ≤ ≤ 1 v ,v 2 1 ξ (e) = k j kk2 = . (1) (vl,vl+1) kvj,vkk2 |k−j|21 216 This means that if we sum up the loads of the k j path edges (vj,vj+1),...,(vk 1,vk) due to edge 1 1 − − 217 e = (vj,vk), we have the weight kvj,vkk22 = |k−j|2 of that edge. For each path edge (vl,vl+1), the sum 218 of loads on that edge caused by all edges e G˜ is called the load of (vl,vl+1) by G˜, and is denoted by ∈ 1This argument does not work for the original (non-snowflake) metric ϑ = (ϑ,k·k), as there the number of i-level net-pointsis proportional to n. Thus thesum of radii of all i-levelnet-points is constant, and therefore R=Ω(logn). 2i 6 219 ξ(vl,vl+1) = ξ(vl,vl+1)(G˜). The load of the graph G˜, ξ(G˜), is the sum of loads over all path edges (vl,vl+1) 220 by G˜, i.e., ξ(G˜) = l [n 1]ξ(vl,vl+1)(G˜). A double counting argument (see Observation 3.5 below for 221 more details) yields W˜P=∈ξ(−G˜). We have thus reduced the problem of lower bounding R˜ to that of lower 222 bounding the load ξ(G˜) of G˜. To get someintuition, consider firstthegraph G˜ from Figure 2, which correspondsto the case n = 17. It is easy to see that each path edge is loaded by a single edge of Π , for each i [0,1]. For example, i ∈ edge (v ,v ) is loaded by edge (v ,v ) of path Π and edge (v ,v ) of path Π , and we thus have 1 2 1 2 0 1 5 1 1 3 ξ (G˜) = ξ (v ,v )+ξ (v ,v ) = 1+ = . (v1,v2) (v1,v2) 1 2 (v1,v2) 1 5 2 2 223 Thus W˜ = ξ(G˜)= l [16]ξ(vl,vl+1)(G˜)= 32 ·16 = 23 ·ω(MST(ϑ˜)). We turn to the case of general n. Consider any paPth∈edge (v ,v ). It is loaded by a single edge e of Π , for each level i [0,ℓ˜ 1], l l+1 i i and its load caused by edge e is given by ξ (e ) = 1. Summing over all ℓ˜levels, we h∈ave − i (vl,vl+1) i 2i ℓ˜ 1 ℓ˜ 1 ξ (G˜) = − ξ (e ) = − 1 2. (vl,vl+1) (vl,vl+1) i 2i ≤ Xi=0 Xi=0 We conclude that W˜ = ξ(G˜) = ξ (G˜) 2(n 1) = 2 ω(MST(ϑ˜)). (vl,vl+1) ≤ − · X l [n 1] ∈ − 3.2 Stage I 224 225 We will now analyze an arbitrary snowflake metric X˜ = (X,δα), where 0 < α < 1. In this first stage we 226 will construct an auxiliary graph G˜ = (X,E˜,w˜) whose weight W˜ = ω˜(G˜) is at least as large as R˜ (up to 227 a constant). The graph G˜ will be given as the union of ℓ˜simple paths, and is thus more convenient for 228 analysis purposes than the standard net-tree spanner. The vertex set of this graph G˜ is equal to X, and 229 G˜ is equipped with a weight function w˜ which is dominated by the distance function δα. 230 To mimic the 1-dimensional case, we start by computing a Hamiltonian path Π = (v1,...,vn) for X˜ 231 of weight ω(Π) = i [n 1]δα(vi,vi+1)atmost O(ω(MST(X˜))). (Computingsuch apath Πisa standard 232 procedure, whichPcan∈be−easily carried out given a constant-factor approximation MST for X˜.) 233 As before, we’d like to compute a set Pi of i-level pivots, for all i [0,ℓ˜ 1] – but this process will ∈ − 234 be carried out more carefully now. Having done that, the graph G˜ will be obtained as before, from the 235 union of the ℓ˜paths Π0,...,Πℓ˜ 1, with each Πi connecting the set Pi of i-level pivots via a simple path. 236 We show how to compute th−e set Pi of i-level pivots, for i [0,ℓ˜ 1]. Recall that in the 1-dimensional ∈ − 237 case, any two consecutive i-level pivots are at (snowflake) distance exactly 2i apart; we cannot achieve 238 this property in the general case. Instead, we will make surethat the distance between consecutive pivots 239 will be at least 2i−1. (The reason we use a distance threshold of 2i−1 rather than 2i is technical – this 240 enables us to guarantee that Pi N˜i .) 241 For i= 0, wesimplytake P|0 =| ≥X| =| v1,...,vn , andΠ0 = Π= (v1,...,vn). Nextconsideri [ℓ˜ 1]. { } ∈ − (i) (i) (i) (i) 242 The first i-level pivot p1 is v1. Having assigned the j first i-level pivots p1 ,...,pj , the next pivot pj+1 243 is the firstpoint after pj(i) in Π which is at distance at least 2i−1 from it. Formally, let k be the index such 244 that p(ji) = vk, and let k′ be the smallest index after k such that δα(p(ji),vk′) ≥ 2i−1. Then p(ji+)1 = vk′ 245 For i [0,ℓ˜ 1], the i-level path Πi is a simple path over the i-level pivots. Although an edge e may ∈ − 246 be very long, we set the weight ω˜(e) of each edge e of path Πi to be 2i−1, and it follows that the edge 247 weights ω˜(e) of edges e Πi will be dominated by the corresponding snowflake distances. (Indeed, by ∈ 248 construction, thesnowflakedistance between any pairof consecutive i-level pivots is atleast 2i−1.) Recall 249 that in the 1-dimensional case we used the weights ω() as given by the snowflake distances – here we use · 7 250 different weights ω˜() that are dominated by ω(). Denote the edge set of Πi by E˜i, with E˜i = Pi 1. · · | | | |− 251 Let G˜ = (X,E˜,ω˜) be the graph obtained from the union of the ℓ˜paths Π0,...,Πℓ˜ 1, with E˜ = iℓ˜=−01E˜i, 252 and ω˜ is the weight function as defined above. − S 253 As in the 1-dimensional case, we next show that the weight W˜ of G˜ is not much smaller than R˜. 254 The analysis starts with the next observation, which follows immediately from the construction. (i) (i) 255 Observation 3.1. Let pj = vk and pj+1 = vk′ be arbitrary consecutive i-level pivots, with k < k′. Then 256 for any index j ∈ [k,k′ −1], δα(pj(i),vj) < 2i−1. Hence for any j,ˆj ∈[k,k′ −1], δα(vj,vˆj) < 2i. 257 We argue that the number of i-level pivots is no smaller than the number of i-level net-points. 258 Lemma 3.2. Pi N˜i . | |≥ | | 259 Proof: Since the i-level net N˜i is a 2i-packing, any two i-level net-points are at distance at least 2i (i) (i) 260 apart. By Observation 3.1, for any two consecutive i-level pivots pj = vk and pj+1 = vk′, with k < k′, 261 at most one point from vk,...,vk′ 1 belongs to N˜i. The lemma follows. { − } 262 Lemma 3.3. For each i ∈[0,ℓ˜−1], |E˜i| = |Pi|−1 ≥ 21 ·|Pi| ≥ 21 ·|N˜i|. 263 Proof: The first equality is immediate from the construction and the third inequality follows from 264 Lemma 3.2. In what follows we prove the second inequality |Pi|−1 ≥ 12 ·|Pi|, or equivalently |Pi|≥ 2. 265 If all indices k ∈ [2,n] satisfied δα(p1(i) = v1,vk) < 2i−1, the distance between any two points of X 266 would be smaller than 2i < ∆˜, a contradiction. Let k′ be the smallest index for which δα(p(1i) = v1,vk′)≥ 267 2i−1. By construction, vk′ will be the second i-level pivot p(2i). Hence |Pi|≥ 2, and we are done. 268 Lemma 3.3 implies that the weight W˜ = ω˜(G˜) of G˜ is not much smaller than R˜. 269 Corollary 3.4. W˜ R˜. ≥ 4 Proof: For each i [0,ℓ˜ 1], we denote by R˜ the sum of radii of all i-level net-points. Observe that i ∈ − R˜ = N˜ 2i. By Lemma 3.3 and the construction, we have i i | |· 1 1 R˜ W˜ = ω˜(Π ) = E˜ 2i 1 N˜ 2i 1 = R˜ = . i i − i − i | |· ≥ 2 ·| |· 4 · 4 i [X0,ℓ˜ 1] i [X0,ℓ˜ 1] i [X0,ℓ˜ 1] i [X0,ℓ˜ 1] ∈ − ∈ − ∈ − ∈ − 3.3 Stage II 270 271 InthissecondstageweshowthatW˜ = O( 1 ) ω(MST(X˜). Weuseachargingscheme, whichgeneralizes 1 α · 272 the one used in Section 3.1: − 273 1. First, we distributethe weight of each edge of G˜ between the path edges in Π that it “loads”. (This 274 is where we leverage on the fact that the metric X˜ = (X,δα) is a snowflake, by using the original 275 distance function δ.) 276 2. Second,weshowthattheloadincurredinthiswaybyeachpathedge(vl,vl+1)isO(11α)·δα(vl,vl+1). 277 This implies that the weight W˜ = ω˜(G˜) of G˜ does not exceed the weight ω(Π) of−the underlying 278 path Π by more than a factor of 1 , thereby giving W˜ = O( 1 ) ω(Π) =O( 1 ) ω(MST(X˜)). 1 α 1 α · 1 α · − − − The path distance δΠ(vj,vk) between a pair vj,vk ∈ X of points is given by ik=−j1δ(vi,vi+1), i.e., the pathdistanceisdefinedwithrespecttotheoriginal(non-snowflake)distancefuncPtionδ. AsinSection3.1, any edge (v ,v ) of path Π =(v ,...,v ) will be called a path edge. Also, we say that edge e = (v ,v ) l l+1 1 n j k (with 1 j < k n) loads a path edge (v ,v ) if j l < l+1 k. Thus edge (v ,v ) loads the k j l l+1 j k ≤ ≤ ≤ ≤ − path edges (v ,v ),...,(v ,v ). Next we would like to distribute the weight ω˜(e) of edge e = (v ,v ) j j+1 k 1 k j k − 8 to all the path edges that it loads. Specifically, the load ξ (e) on path edge (v ,v ) caused by (vl,vl+1) l l+1 edge e = (v ,v ) G˜, for j l < l+1 k, is defined as j k ∈ ≤ ≤ δ(v ,v ) l l+1 ξ (e) = ω˜(e) . (2) (vl,vl+1) · δ (v ,v ) Π j k 279 (Note that this definition generalizes Equation (1) from Section 3.1.) It is easy to see that the weight 280 ω˜(e) of edge e in G˜ is distributed between all the path edges that it loads, so that the sum of loads on 281 these path edges caused by edge e is equal to ω˜(e). Also, the load on a specific path edge (vl,vl+1) caused 282 by edge e G˜ is relative to the ratio between the weight of this path edge (with respect to the original ∈ 283 metric δ) and the total weight of all the path edges that are loaded by edge e (also with respect to the 284 original metric δ), where the latter term is exactly the path distance between the two endpoints of e. 285 For each path edge (vl,vl+1), the sum of loads on that edge caused by all edges e G˜, is called the ∈ 286 load of (vl,vl+1) by G˜, and denoted by ξ(vl,vl+1) = ξ(vl,vl+1)(G˜). The load of the graph G˜, ξ(G˜), is the sum 287 of loads over all path edges (vl,vl+1) by G˜, i.e., ξ(G˜) = l [n 1]ξ(vl,vl+1)(G˜). A double counting yields: ∈ − 288 P 289 Observation 3.5. W˜ = e G˜ω˜(e) = e G˜ l [n 1]ξ(vl,vl+1)(e) = l [n 1]ξ(vl,vl+1)(G˜) = ξ(G˜). ∈ ∈ ∈ − ∈ − P P P P 290 We have thus reduced the problem of lower bounding R˜ to that of lower bounding the load ξ(G˜) of 291 G˜. 292 We use the following lemma to complete the argument. 293 Lemma 3.6. For any index l ∈ [n−1], ξ(vl,vl+1)(G˜) = O(11α)·δα(vl,vl+1). − Proof: Fix any index l [n 1]. Note that edge (v ,v ) is loaded by a single edge of Π , for each l l+1 i ∈ − i [0,ℓ˜ 1], denoted e . Specifically, edge e connects a pair of consecutive i-level pivots p(i) =v ,p(i) = ∈ − i i j k j+1 v , such that k l < l+1 k , and δα(p(i),p(i) ) 2i 1. Note that all edges of Π in G˜ have weight k′ ≤ ≤ ′ j j+1 ≥ − i 2i 1, and so ω˜(e ) = 2i 1. Thus the load on edge (v ,v ) incurred in level i [0,ℓ˜ 1] is given by − i − l l+1 ∈ − δ(v ,v ) δ(v ,v ) ξ (e ) = ω˜(e ) l l+1 = 2i 1 l l+1 , (vl,vl+1) i i · δ (p(i),p(i) ) − · δ (p(i),p(i) ) Π j j+1 Π j j+1 and so the total load on edge (v ,v ) by G˜ is equal to l l+1 δ(v ,v ) ξ (G˜) = ξ (e ) = 2i 1 l l+1 . (vl,vl+1) i [X0,ℓ˜ 1] (vl,vl+1) i i [X0,ℓ˜ 1] − · δΠ(p(ji),p(ji+)1) ∈ − ∈ − Define η = δα(v ,v ),t = logη . We first bound the load on edge (v ,v ) incurred in levels i [0,t]. l l+1 l l+1 ⌈ ⌉ ∈ Since δ(v ,v ) δ (p(i),p(i) ), we have ξ (e ) 2i 1. It follows that l l+1 ≤ Π j j+1 (vl,vl+1) i ≤ − ξ (e ) 2i 1 < 2η = O(δα(v ,v )). (vl,vl+1) i ≤ − l l+1 X X i [0,t] i [0,t] ∈ ∈ Next, we bound the load on edge (v ,v ) incurred in levels i [t+1,ℓ˜ 1]. We have l l+1 ∈ − δα(p(i),p(i) ) 2i 1 = 2t 2i 1 t η 2i 1 t, j j+1 ≥ − · − − ≥ · − − (i) (i) 1 i−1−t (i) (i) (i) (i) 1 i−1−t and so δ(pj ,pj+1) ≥ ηα ·2 α . By the triangle inequality, δΠ(pj ,pj+1) ≥ δ(pj ,pj+1) ≥ ηα ·2 α . Note also that 2i 1 = 2t 2i 1 t 2η 2i 1 t. Hence the load on edge (v ,v ) incurred in level − − − − − l l+1 i [t+1,ℓ˜ 1] is given by· ≤ · ∈ − 1 ξ(vl,vl+1)(ei) = 2i−1· δΠδ((pvj(li,)v,lp+j(1i+))1) ≤ 2η·2i−1−t· ηα1 ·η2αi−α1−t = 2η·2(i−1−t)(1−α1). 9