Logout succeed
Logout succeed. See you again!
JBCB, 11(6):1343008, December 2013 - School of Computing PDF
Preview JBCB, 11(6):1343008, December 2013 - School of Computing
October 8, 2013 19:9 WSPC/INSTRUCTION FILE ws-jbcb JournalofBioinformaticsandComputationalBiology (cid:13)c ImperialCollegePress Recognising Discourse Causality Triggers in the Biomedical Domain ClaudiuMih˘ail˘aandSophiaAnaniadou The National Centre for Text Mining School of Computer Science, The University of Manchester, 131 Princess Street, Manchester, M1 7DN, United Kingdom {claudiu.mihaila, sophia.ananiadou}@manchester.ac.uk Received(DayMonthYear) Revised(DayMonthYear) Accepted(DayMonthYear) Currentdomain-specificinformationextractionsystemsrepresentanimportantresource for biomedical researchers, who need to process vast amounts of knowledge in a short time. Automatic discourse causality recognition can further reduce their workload by suggesting possible causal connections and aiding in the curation of pathway models. Wedescribehereanapproachtotheautomaticidentificationofdiscoursecausalitytrig- gers in the biomedical domain using machine learning. We create several baselines and experimentwithandcomparevariousparametersettingsforthreealgorithms,i.e.,Con- ditional Random Fields (CRF), Support Vector Machines (SVM) and Random Forests (RF). We also evaluate the impact of lexical, syntactic and semantic features on each of the algorithms, showing that semantics improves the performance in all cases. We testourcomprehensivefeaturesetontwocorporacontaininggoldstandardannotations of causal relations, and demonstrate the need for more gold standard data. The best performanceof79.35%F-scoreisachievedbyCRFswhenusingallthreefeaturetypes. Keywords:discourseanalysis;causality;textmining;biomedicaltextmining. 1. Introduction Ithasbecomeincreasinglyimportanttobeabletoprovideautomated,efficientand accurate means of retrieving and extracting user-oriented biomedical knowledge, considering the ever-increasing amount of knowledge published daily in the form of research articles.1,5 Based on this need, biomedical text mining has seen significant recent advancements in the last few years,39 including named entity recognition,7 coreference resolution2,34 and relation19,28 and event extraction.21,20 Additionally, biomedicaltextminingtoolshavebeenincludedinspecifically-designedframeworks and systems, in which biomedical researchers can easily build workflows to extract information, such as Argo30 and U-Compare,11,14 or create and curate pathways and link them to the literature, such as PathText.12 Using biomedical text mining technology,textcannowbeenrichedviatheadditionofsemanticmetadataandthus cansupporttaskssuchasanalysingmolecularpathways32andsemanticsearching.22 1 October 8, 2013 19:9 WSPC/INSTRUCTION FILE ws-jbcb 2 Claudiu Miha˘il˘a and Sophia Ananiadou However, most of the undertaken research is restricted to punctual facts that areexpressedinatmostonesentenceifnotoneclause.Morecomplextasks,suchas question answering and automatic summarisation, require the extraction of infor- mationthatspansacrossseveralsentences,togetherwiththerecognitionofrelations thatexistacrosssentenceboundaries,inordertoachievehighlevelsofperformance. These relations, such as causal, temporal and conditional, which characterise how factsintextarerelated,createacoherentsequenceofclausesandsentences,known as discourse. Thus, the relations that connect facts in a logical manner are known as discourse relations. These help readers to infer deeper, more complex knowledge aboutthefactsmentionedinthediscourse.Theserelationscanbeeitherexplicitor implicit, depending whether or not they are expressed in text using overt discourse connectives (also known as triggers). Take, for instance, the case in example (1), where the trigger Therefore signals a justification between the two sentences: be- cause “a normal response to mild acid pH from PmrB requires both a periplasmic histidine and several glutamic acid residues”, the authors believe that the “regula- tion of PmrB activity could involve protonation of some amino acids”. (1) In the case of PmrB, a normal response to mild acid pH requires not only a periplasmic histidine but also several glutamic acid residues. Therefore, regulation of PmrB activity may involve protonation of one or more of these amino acids. Thus, by identifying these types of causal relations, search engines become able to automatically discover possibly novel relations between biomedical entities, pro- cessesandeventsorbetweenexperimentalevidenceandassociatedconclusions.This canhappenespeciallyifthemechanismisappliedtoacollectionofarticles,someof whichmightbeoverlookedbyhumans.However,phrasesactingascausaltriggersin certaincontextsmaynotdenotecausalityinallcases.Therefore,adictionary-based approach is likely to produce a very high number of false positives. In this article, wedescribethefirstsupervisedmachine-learningapproachestotheautomaticiden- tification of triggers that actually denote causality. We show that by adding a deep semantic layer of information, the performance can increase significantly, and that more gold standard data is much needed for better results. 2. Related work A large amount of work related to discourse parsing and discourse relation iden- tification exists in the general domain, where researchers have not only identified discourse connectives, but also developed end-to-end discourse parsers. Most work isbasedonthePennDiscourseTreebank(PDTB),26 acorpusoflexically-grounded annotations of discourse relations. Some researchers have tackled the problem of identifying discourse connectives, but without determining the discourse relation, as a disambiguation task.25 Using almost exclusively syntactic features related to the trigger, they achieve an F-score October 8, 2013 19:9 WSPC/INSTRUCTION FILE ws-jbcb Recognising Discourse Causality Triggers in the Biomedical Domain 3 of around 95%. Basingontheabovework,otherresearchersintroducednewfeaturesandmanage toslightlyimprovetheoverallperformance.16 Theyincludedfeaturesrelatedtothe immediate context of the discourse trigger, such as the previous and next words, their part-of-speech and syntactic interaction with the trigger itself. Also, they addedasafeaturetheentirepathfromtheconnectivetotherootoftheparsetree. A further two approaches consider the syntactic constituency and dependency structure of the context of the trigger.37 Features include the path from the trigger tothesyntacticroot,syntacticcontextfeaturesandconjunctivefeaturesinthecase of the syntactic approach, whilst the dependency approach relies on features such as immediately neighbouring words and their part-of-speech, parents and siblings of the connective and clause detection. Another small increase in F-score, with just under 1% over Ref. 25 and even less over Ref. 37 is reached by combining certain aspects of the surface level and syntactic feature sets of these respective works.9 Until now, comparatively little work has been carried out on causal discourse relationsinthebiomedicaldomain,althoughcausalassociationsbetweenbiological entities,eventsandprocessesarecentraltomostclaimsofinterest.13Theequivalent of the PDTB for the biomedical domain is the BioDRB corpus,27 containing 16 typesofdiscourserelations,e.g.,temporal,causalandconditional.Aslightlylarger corpus is BioCause,18 containing manually annotated causal discourse relations in full-text open-access journal articles from the infectious diseases domain. To the best of our knowledge, there is no previous work identifying discourse causalrelations inthebiomedical domain.Using the BioDRBcorpus asdata,some researchershaveexploredtheidentificationofdiscourseconnectives.31 Theydonot distinguish, however, between the types of discourse relations and identify them as discourse markers in general. Using mostly a set of orthographic features, they obtainthebestF-scoreof75.7%usingCRF,withSVMreachingonly65.7%.These results were obtained by using only syntactic features, as semantic features were shown to lower the performance. Also, they prove that there exist differences in discoursetriggersbetweenthebiomedicalandgeneraldomainsbytrainingamodel on the BioDRB and evaluating it against PDTB and vice-versa. The same conclusions were reached in another study,9 which manages to im- prove these results by around 3%. They notice that the automatic named entity recognition performed by ABNER35 lowers the overall performance, due to its use of orthographic features, which thus become duplicated in the feature vector. 3. Methodology In this section, we describe our data and the features of causal triggers. We also explain our evaluation methodology. October 8, 2013 19:9 WSPC/INSTRUCTION FILE ws-jbcb 4 Claudiu Miha˘il˘a and Sophia Ananiadou 3.1. Data The data for the experiments comes from the BioCause and BioDRB corpora. Bio- Cause is a collection of 19 open-access full-text journal articles pertaining to the biomedical subdomain of infectious diseases, manually annotated with 850 causal relationships.Twotypesofspansoftextaremarkedinthetext,namelycausaltrig- gers and causal arguments. Each causal relation is composed of three text-bound annotations: a trigger, a cause or evidence argument and an effect argument. Some causal relations have implicit triggers, so these are excluded from the current re- search. Fig.1.CausalrelationintheBioCause. Figure 1 shows an example of discourse causality from BioCause, marking the causaltriggerandthetwoargumentswiththeirrespectiverelation.Namedentities are also marked in this example. BioCause contains 381 unique explicit triggers, each being used, on average, only 2.10 times. The number decreases to 347 unique triggers when they are lem- matised, corresponding to an average usage of 2.30 times per trigger. Both count settings demonstrate the diversity of causality-triggering phrases that are used in the biomedical domain. The BioDRB corpus spreads over 24 articles, and the number of purely causal relationsannotatedinthiscorpusis542.Thereareanother23relationswhicharea mixture between causality and one of either background, temporal, conjunction or reinforcementrelations.Theserelationsarebasedononly45differenttriggertypes. 3.2. Features Three types of features have been employed in the development of this causality trigger model, i.e., lexical, syntactic and semantic. These features are categorised and described below. 3.2.1. Lexical features The lexical features are built from the actual tokens present in text. Tokenisation is performed by the GENIA tagger36 using the biomedical model. The first two features represent the token’s surface expression and its base form. October 8, 2013 19:9 WSPC/INSTRUCTION FILE ws-jbcb Recognising Discourse Causality Triggers in the Biomedical Domain 5 Neighbouring tokens have also been considered. We included the token imme- diately to the left and the one immediately to the right of the current token. This decisionisbasedontwoobservations.Firstly,inthecaseoftokenstotheleft,most triggers are found either at the beginning of the sentence (311 instances) or are preceded by a comma (238 instances). These two left contexts represent 69% of all triggers. Secondly, for the tokens to the right, almost 45% of triggers are followed by a determiner, such as the, a or an, (281 instances) or a comma (71 instances). 3.2.2. Syntactic features The syntax, dependency and predicate argument structure are produced by the Enju parser.23 Figure 2 depicts a partial lexical parse tree of a sentence which startswithacausaltrigger,namelyOur results suggest that.Fromthelexicalparse trees, several types of features have been generated. Fig.2.Partiallexicalparsetreeofasentencestartingwithacausaltrigger. The first two features represent the part-of-speech and syntactic category of a token. For instance, Figure 2 shows that the token that has the part-of-speech IN. Thesefeaturesareincludedduetothefactthateithermanytriggersarelexicalised as an adverb or conjunction, or are part of a verb phrase. For the same reason, the syntactical category path from the root of the lexical parse tree to the token is also included. The path also encodes, for each parent constituent, the position of the token in its subtree, i.e., beginning (B), inside (I) or end (E); if the token is the only leaf node of the constituent, this is marked differently, using a C. Thus, the path of that, highlighted in the figure, is I-S/I-VP/B-CP/C-CX. Secondly, for each token, we extracted the predicate argument structure and checkedwhetherarelationexistsbetweenthetokenandthepreviousandfollowing tokens. The values for this feature represent the argument number as allocated by Enju. Thirdly,theancestorsofeachtokentothethirddegreeareinstantiatedasthree different features. In the case that such ancestors do not exist (i.e., the root of October 8, 2013 19:9 WSPC/INSTRUCTION FILE ws-jbcb 6 Claudiu Miha˘il˘a and Sophia Ananiadou the lexical parse tree is less than three nodes away), a ”none” value is given. For instance, the token that in Figure 2 has as its first three ancestors the constituents marked with CX, CP and VP. Finally,thelowestcommonancestorinthelexicalparsetreebetweenthecurrent token and its left neighbour has been included. In the example, the lowest common ancestor for that and suggest is VP. These last two feature types have been used based on the observation that the lowest common ancestor for all tokens in a causal trigger is S or VP in over 70% of instances. Furthermore, the percentage of cases of triggers with V or ADV as the lowest common ancestor is almost 9% in each case. Also, the average distance to the lowest common ancestor is 3. 3.2.3. Semantic features We have exploited several semantic knowledge sources to identify causal triggers more accurately, as a mapping to concepts and named entities acts as a back-off smoothing, thus increasing performance. One semantic knowledge source is the BioCause corpus itself. All documents annotated for causality in BioCause had been previously manually annotated with biomedical named entity and event information. This was performed in the con- text of various shared tasks, such as the BioNLP 2011 Shared Task on Infectious Diseases.29 Wethereforeleveragethisexistinginformationtoaddanothersemantic layer to the model. Moreover, another advantage of having a gold standard anno- tation is the fact that it is now possible to separate the task of automatic causal trigger recognition from automatic named entity recognition and event extraction. The named entity and event annotation in the BioCause corpus is used to extract information about whether a token is part of a named entity or event trigger. Fur- thermore, the type of the named entity or event is included as a separate feature. The second semantic knowledge source is WordNet.6 Using this resource, the hypernym of every token in the text has been included as a feature. Only the first senseofeverytokenhasbeenconsidered,asnosensedisambiguationtechniquehas been employed. Finally, tokens have been linked to the Unified Medical Language System (UMLS)3 semantic types. Thus, we included a feature to say whether a token is part of a UMLS type and another for its semantic type if the previous is true. 3.3. Experimental setup Weexploredtheuseofvariousmachinelearningalgorithmsandvarioussettingsfor the task of identifying causal triggers. Ontheonehand,weexperimentedwithCRF,15 aprobabilisticmodellingframe- work commonly used for sequence labelling tasks. In this work, we employed the October 8, 2013 19:9 WSPC/INSTRUCTION FILE ws-jbcb Recognising Discourse Causality Triggers in the Biomedical Domain 7 CRFSuite implementation.a On the other hand, we modelled trigger detection as a classification task, using Support Vector Machines and Random Forests. More specifically, we employed the implementation in Weka8,38 for RFs, and LibSVM4 for SVMs. Furthermore, we evaluated the best model on BioCause and BioDRB, cross- validatedthemodelsbetweenBioCauseandBioDRBandevaluatedamodeltrained on both corpora. 4. Results and discussion Several models have been developed and 10-fold cross-evaluated to examine the complexity of the task and the impact of various feature types (lexical, syntactic, semantic). Table 1 shows the performance evaluation of baseline systems and other classifiers. It should be noted that the dataset is highly skewed, with a ratio of positive examples to negative examples of approximately 1:52. Table 1. Performance of various classifiers in identifying causal con- nectives Classifier P R F1 Dict 0.08 1.00 0.15 Depend 0.08 0.77 0.14 Synt 0.15 0.20 0.17 Dict+Depend 0.14 0.75 0.24 Dict+Synt 0.22 0.20 0.21 CRF 0.89 0.74 0.79 SVM 0.88 0.61 0.70 RandFor 0.78 0.67 0.72 Several baselines have been devised. The first baseline is a dictionary-based heuristic, named Dict. A lexicon is populated with all annotated causal triggers and then this is used to tag all instances of its entries in the text as connectives. The precision of this heuristic is very low, 8.36%, which leads to an F-score of 15.43%, considering that the recall is 100%. This is mainly due to words and/or phrases which are rarely used as causal triggers, such as and, by and that. Based on the previously mentioned observation about the lowest common an- cestor for all tokens in a causal trigger, we built a baseline system that checks all constituentnodesinthelexicalparsetreefortheS,V,VPandADVtagsandmarks them as causal triggers. The name of this system is Depend. Not only does Depend obtain a slightly lower precision than Dict, but it also performs worse in terms of ahttp://www.chokkan.org/software/crfsuite October 8, 2013 19:9 WSPC/INSTRUCTION FILE ws-jbcb 8 Claudiu Miha˘il˘a and Sophia Ananiadou recall.TheF-scoreis13.68%,largelyduetothehighnumberofintermediatenodes in the lexical parse tree that have VP as their category. Thethirdbaselineisasyntax-basedapproach,Synt.Weextractedthesyntactic patternsfromalltriggers,creatingasetof167uniquepatterns.Afterexperimenting with possible combinations of patterns to search for, the best performing pattern was found to be V-C (verb-complementiser), which occurs in 20.45% of triggers. It gives a precision of 14.61% and a recall of 20.45%, thus resulting in an F-score of 17.04%. We then combined Dict and Depend: we considered only constituents that have thenecessarycategory(S,V,VPorADV)andincludeatriggerfromthedictionary. Although the recall decreases slightly, the precision increases to almost twice that ofbothDict andDepend.ThisproducesamuchbetterF-scoreof24.03%.Similarly, thecombinationofDict andSynt resultsinaprecisionof21.88%,arecallof20.45%, and thus in an F-score of 21.14%. Table2.Effectoffeaturetypesonthecausaltriggerrecognition. CRF RF SVM Features P R F1 P R F1 P R F1 Lex 0.89 0.67 0.74 0.78 0.68 0.73 0.81 0.61 0.69 Syn 0.92 0.69 0.76 0.68 0.62 0.65 0.83 0.56 0.67 Sem 0.87 0.63 0.69 0.84 0.57 0.68 0.85 0.57 0.68 Lex+Syn 0.88 0.73 0.79 0.77 0.66 0.71 0.86 0.54 0.67 Lex+Sem 0.90 0.69 0.76 0.79 0.68 0.73 0.82 0.61 0.70 Syn+Sem 0.87 0.73 0.78 0.72 0.64 0.68 0.84 0.55 0.67 Lex+Syn+Sem 0.89 0.74 0.79 0.78 0.67 0.72 0.88 0.54 0.67 Table 2 shows the effect of different feature types on CRFs, RFs and SVMs. In the case of CRFs, as can be observed, the best performances, in terms of F- score, including the previously mentioned ones, are obtained when combining all three types of features, i.e., lexical, syntactic and semantic. The best precision and recall, however, are not necessarily achieved by using all three feature types. The best precision is obtained by using the syntactic features only, reaching over 92%, almost 3% higher than when all three feature types are used. As can be noticed, the best performance of RFs is obtained when combining lexical and semantic features. Due to the fact that causal triggers do not have a semantic mapping to concepts in the named entity and UMLS annotations, the treesintherandomforestclassifiercaneasilyproducerulesthatdistinguishtriggers from non-triggers. As such, the use of semantic features alone produce a very good precision of 84.34%. Also, in all cases where semantic features are combined with other feature types, the precision increases by 0.5% in the case of lexical features and 3.5% in the case of syntactic features. However, the recall of semantic features alone is the lowest. The best recall is obtained when using only lexical features. October 8, 2013 19:9 WSPC/INSTRUCTION FILE ws-jbcb Recognising Discourse Causality Triggers in the Biomedical Domain 9 For SVMs, we have experimented with two kernels, namely polynomial (second degree) and radial basis function (RBF) kernels. For each of these two kernels, we have evaluated various combinations of parameter values for cost and weight. Both these kernels achieved similar results, indicating that the feature space is not linearly separable and that the problem is highly complex. The effect of feature types on the performance of SVMs is shown in Table 2. As can be observed, the best performance is obtained when combining the lexical and semantic feature types (69.85% F-score). The combination of all features pro- ducesthebestprecision,whilstthebestrecallisobtainedbycombininglexicaland semantic features. As we expected, the majority of errors arise from sequences of tokens which are only used infrequently as non-causal triggers. This applies to 107 trigger types, whose number of false positives (FP) is higher than the number of true positives (TP).Infact,64triggertypesoccuronlyonceasacausalinstance,whilsttheaver- age number of FPs for these types is 14.25. One such example is and, for which the numberofnon-causalinstances(2305)ismuchgreaterthanthatofcausalinstances (1). Other examples of trigger types more commonly used as causal triggers, are suggesting (9TP,54FP),indicating (8TP,41FP)andresulting in (6TP,14FP). For instance, example (2) contains two mentions of indicating, but neither of them implies causality. (2) Buffer treated control cells showed intense green staining with syto9 (in- dicating viability) and a lack of PI staining (indicating no dead/dying cells or DNA release). We have also evaluated our feature set using the BioDRB corpus. This corpus differs from the BioCause corpus in one important aspect: it does not contain any semantic annotation related to named entities or events. This means that, for the purposeofconductingexperimentsontheBioDRBinasimilarmanner,weneedto include a pre-processing step that recognises named entities. Forthis,weusedasimplemethodthataugmentstheannotationwiththenamed entities present in the output of three named entity recognition tools (NERs), i.e. Metamap, NeMine33 and OSCAR10. The types of entities in the output be each of the three tools, together with the NE types present in the UK PubMed Central (UKPMC)17, are summarised in Table 3. UK PubMed Central is an article database that extends the functionality of the original PubMed Central (PMC) repository.b Named entities in the UKPMC database were identified using NeMine, a dictionary-based statistical named entity recognition system. This system was later extended and used to recognise more types, such as phenomena, processes, organs and symptoms.24 We used this most bhttp://www.ncbi.nlm.nih.gov/pmc October 8, 2013 19:9 WSPC/INSTRUCTION FILE ws-jbcb 10 Claudiu Miha˘il˘a and Sophia Ananiadou Table3.Namedentitytypesandtheirsource. Type UKPMC NeMine OSCAR Gene (cid:88) (cid:88) Protein (cid:88) (cid:88) Gene—Protein (cid:88) Disease (cid:88) (cid:88) Drug (cid:88) (cid:88) Metabolite (cid:88) (cid:88) Bacteria (cid:88) Diagnosticprocess (cid:88) Generalphenomenon (cid:88) Indicator (cid:88) Naturalphenomenon (cid:88) Organ (cid:88) Pathologicfunction (cid:88) Symptom (cid:88) Therapeuticprocess (cid:88) Chemicalmolecule (cid:88) Chemicaladjective (cid:88) Enzyme (cid:88) Reaction (cid:88) recent version of the software as our second source of more diverse entity types. The Open-Source Chemistry Analysis Routines (OSCAR) software is a toolkit for the recognition of named entities and data in chemistry publications. Currently in its fourth version, it uses three types of chemical entity recognisers, namely regular expressions, patterns and Maximum Entropy Markov models. AfteraugmentingtheexistingNEsbyrunningthetwoNERtoolsonthecorpus, the outputs were combined to give a single “silver” annotation list. This operation was performed by computing the mathematical union of the three individual anno- tation sets, as shown in Eq. 1. A =A ∪A ∪A ∪A (1) Silver Metamap Oscar NeMine UKPMC For reasons of fairness, the gold standard semantic annotation in the BioCause corpus has been removed and replaced with automatic NER results. For the evaluation, we used the best performing algorithm and its parameter settings, i.e. CRF with all three types of features. We created different models and evaluated them in various ways, and the results of these tests are given in Table 4. The first two columns of the table show the training corpus and the test corpus, respectively, for that respective test. In the case of 10-fold cross validation, 10X is used. As can be observed, the model trained on the BioDRB corpus obtains a higher precision than the one trained the BioCause. This is mainly due to the smaller set of unique connectives present in the BioDRB. The recall is, however, lower, and, overall, the F-score for the BioDRB model is 1% lower than the F-score for the BioCause model.