Logout succeed
Logout succeed. See you again!

Ferromagnetic Nano-Structures in Valenta Model PDF
Preview Ferromagnetic Nano-Structures in Valenta Model
APS/123-QED Ferromagnetic nano-structures in Valenta model I. Zasada∗ and B. Busiakiewicz Solid State Physics Department, University of Lodz, ul. Pomorska 149/153, Lodz, Poland 9 (Dated: January 9, 2009) 0 0 2 Abstract n a The ferromagnetic nano-structures are recently of great interest for modern investigations. A J 9 comparison of the experimental data and theoretical results shows that the use of the standard ] molecularfieldapproximationisinsufficientforthedescriptionofnano-structureproperties. There- i c s fore, we use the effective field approach in order to show the usefulness of the Valenta model - l r generalized in this way. The agreement between experiment and theory is then excellent. t m . The magnetization profiles and the calculated Curie temperatures are presented for the systems t a m consisting of Ni and Co layers with different configuration of the surfaces and interfaces including - d terraces and wires. We have shown that the position in the system as well as the kind of neigh- n o bouring layers and their mutual interactions can determine the shape of magnetization profiles. c [ The use of the Valenta model allows us to present all dependences in the layer resolved mode. 1 v 3 PACS numbers: 5 2 1 . 1 0 9 0 : v i X r a ∗ Electronic address: IZASADA@wfis.uni.lodz.pl 1 I. INTRODUCTION A recent development of nanotechnologies needs still more actual and more effective methods for the description of nano-structures. In this case the ultra-thin films are very convenient systems in order to describe their properties as a starting point towards the nano-objects. In the above circumstances the description of magnetic thin films is of fundamental significance from the theoretical point of view because of their role in the interpretation for the thermodynamics applied to inhomogeneous media and for the quantum mechanics of objects with restricted dimensions. The problem of the thin films theory is rather old, but the model introduced by Valenta fifty years ago [1, 2] seems to be still an excellent and effective approach for the character- ization of the magnetization properties and the phase transition temperature. The model formally equivalent to molecular field approximation is based on broader physical back- ground and represents an original interpretation from the physical point of view. The model in its extended form allows us to discuss not only the magnetic properties but also the lattice thermodynamic [3], order-disorder [4], electronic phenomena [5] as well as the phase transitions in the context of the stability and surface melting [6]. Recently, a new attempt at the study of different systems and phenomena within the extended Valenta model has been made. First of all, different properties of AB3 binary alloy thin films have been discussed. The long-range order parameter and the concentration distribution, mutually dependent and dependent on the film thickness and the boundary conditions at the surfaces have been analyzed[7,8]. Aninterpretationofthedisordering kinetics hasbeenproposedinconnection with the behaviour of disorder which appears as layer by layer process starting form the surface plane or from the sample inside in dependence on the boundary conditions. An interdependence between the surface melting and the surface disordering observed in binary alloy thin films has been considered in the context of their mutual relations [9, 10]. The presented approach allowed to extend the phase transitions diagrams to the case when the crystallinity parameter behaviour influences the local concentration profiles and the lattice order parameter describing the alloy structure. In particular, the surface-induced disorder was described when the crystal structure is preserved and, in contrast, when the surface 2 melting is expected for partially disordered samples. The behaviour of the magnetization in thebinaryalloythinfilmswithrespect totheirlatticedisorderandtherelativeconcentration of alloy components has been also discussed [11]. An interesting fact is observed when the magnetic order appears for the lattice disorder, i.e. for higher temperatures while there is no magnetization for the lattice-ordered state. The order-disorder phenomena including the distribution of chemical component has been considered as well in terms of the short-range order in binary alloy thin films whose surfaces play an essential role [12]. Among others, two effects seem to be of particularly great interest, namely: the crossover of the site occupancy in the surface layer and the shift of atoms in the surface plane between two kinds of lattice sites. Such effects influence the diffuse low-energy electron diffraction, surface melting or spin-wave resonance conditions. Next, different levels of extensions for the original Valenta model have been proposed in connection with its applicability for magnetic thin films description. The most important one is connected with the improvement of the entropy construction in the self consistent way when the correlations are taken into account [13]. Another kind of extension is connected withintroduction ofthereactionfield instead ofthestandardmolecular field. Theprocedure for the reaction field approach (RFA) consists in adding to the molecular field a correlation dependent term determined by means of the fluctuation-dissipation theorem. The part of the effective field arising from the reaction field does not favor one orientation over another while the molecular field is directed along the spontaneous magnetization axis. The Valenta model generalized in such a way has been applied for the description of ferromagnetic films separated by the nonmagnetic spacer forming the multilayer systems [14]. In the present paper, we show that the Valenta model can be also successfully applied to different ferromagnetic nano-structures. We start with ultra-thin multilayer systems, next we consider the systems with terraces and at the end we discuss the wires properties in connection with different environment conditions. II. THE BACKGROUND OF THE VALENTA MODEL The model introduced by Valenta in its original formulation is formally equivalent to the molecular field approximation, and for this reason, it is at present treated as an insuf- ficient approach for the precise description of thin films properties. However, taking into 3 considerations the original assumptions which are based on the deep physical background, we can modify the model in various aspects with respect to the purposes of the expected interpretations. The Valenta model [1, 2]consists in two assumptions: -thediscretizationofsamplegeometrywhichreflectsthecrystallographiclatticestructure andsomesurfaceirregularitiesconnectedwiththenearestneighboursforeachofthesurfaces. The discrete structure of variables, in particular, the distances between the neighbouring planes in the film thickness direction, leads to the formulation of the equations describing the film in the form of the difference equations with properly chosen boundary conditions. - the thermodynamics modified for inhomogeneous systems. It turns out that a sample with thin film geometry is such an inhomogeneous system from the thermodynamic point of view, so it should be considered in terms of thermodynamics modified for small clusters [15] or nano-structures [16]. A film can be treated as a sample cut in some crystallographic orientation with respect to the surface of the crystal with a given crystallographic structure characterized by the spectrum of the nearest neighbouring atoms. In this case the atoms situated at the surfaces have their neighbourhood which is different withrespect to the considered site vicinity inside a sample. The geometric situation corresponds then to the different conditions in which the atoms at the surface and the atoms inside a sample are embedded. However, the film can be divided into monoatomic layers parallel to the surface planes from which a layer in two dimensions can be treated as thermodynamically homogenous subsystem. From the thermo- dynamic point of view a film is then interpreted as a composition of homogenous subsystems in the sense of N´eel sublattices [17]. The N´eel idea consists here in the division of the system into several groups, sublattices, which form the homogenous subsystems gathering the phys- ically equivalent particles, i.e., equal particles accruing in the physically identical conditions. The N´eel idea applied by Valenta to thin films can be interpreted that the inhomogeneous system can be divided into homogenous subsystems which are identical with monoatomic layers parallel to the surfaces, however, embedded into different neighbourhood. The division of a thin film into homogeneous sublattices which are monoatomic layers parallel to the surface implies in terms of quantum mechanics the assumption [1, 2] that the total wave function of the electrons of a thin film practically differs very little from the wave function of the state in which the components of magnetic moments in the monoatomic 4 layers have well defined values. In these conditions, however, the model corresponds to the situation when the hamiltonians of the subsystems do not commute with the hamiltonian of the system. Although the commutative rules can only be approached, they are satisfied in a very simple case when the interactions between the sublattices are determined by means of the effective field. Thus, at high temperature, the quantum mechanical construction influences the thermo- dynamic interpretation. The hamiltonian of each Nel sublattice corresponds to the integral of motion for each layer. This means that the total wave function of the state is the product of wave functions with respect to an individual sublattice. From the thermodynamic point of view this fact is equivalent to the factorization of the partition functions. The total parti- tion function is factorized with respect to the partition functions of individual monoatomic layers. The statistical operator of a film is then a product of the statistical operators of layers due to the additive character of the effective hamiltonians. As a consequence, the entropy is a sum of terms describing homogeneous contributions of monoatomic layer en- tropies independent of one another in calculations. At low temperatures the construction of a Heisenberg type quantum mechanical theory leads to the solution which can be related to the spin waves propagation or, in the magnon representation, to the quasi free particles when they are embedded in the heat bath of harmonic oscillators. This level of approxima- tion corresponds to the case when the transversal correlations between spins are neglected. Then, the hamiltonian is reduced to the Ising type hamiltonian whose longitudinal correla- tions reduce to the MFA results. In the thin films geometry the direction perpendicular to the surface plane is distinguished in a natural way by breaking the translational symmetry whose perturbation gives the conditions in which the size effects can be observed. One of the fundamental characteristics of the considered model is a discretization of variables, at least, in the film thickness direction. The geometrical properties of a film lead to their description by means of the variational procedure which should be considered in the discrete space. The variational equations are then of difference, not differential, forms. The thermodynamic approach is, in general, based on the free energy functional con- struction: F = U −TS (1) which can be obtained by means of the internal energy U and the entropy S calculations. The internal energy U is defined by the mean value of the Hamiltonian describing the 5 considered system while the entropy in the pair representation is then given in the standard form [13, 18]: S = σν + (σνν′ −σν −σν′) (2) ν <νν′> X X where 1 1 σ = k +m ln +m ν B ν ν 2 2 " (cid:16) (cid:17) (cid:16) (cid:17) 1 1 + −m ln −m (3) ν ν 2 2 # (cid:16) (cid:17) (cid:16) (cid:17) We can see from (2) that the entropy has then two contributions. One of them corresponds to the single-site entropy: S1 = N2 [1−z(ν)]σν (4) ν X for z(ν) denoting the number of nearest neighbours when the central site lies in the plane ν, namely z(ν) = z(ν,ν′) where z(ν,ν′) stands for the number of nearest neighbours in ν′ the plane ν′ whenPthe central site is in the plane ν. N stands for the number of spins in the linear dimension of the plane (nN2 denotes the number of the spins in the system consisting of n layers). The contribution of pair entropy can be written as: 0 1 S2 = S2 +S2 (5) where, the first term contains the contribution introduced in the planes ν, i.e. in the homogeneous subsystems, namely: 1 0 2 S = N z(ν,ν)σ (6) 2 νν 2 ν X and, the second one contains the contribution introduced by the interactions between two monolayers, i.e. the interactions between subsystems embedded into inhomogeneous bath, namely: 1 S21 = N2 z(ν,ν′)σνν′6=ν (7) 2 νν′6=ν X 6 The entropy in each monoatomic layer, following the calculations for homogenous system, is of the form 1 1 σ = k +m +c ln +m +c νν B ν ν ν ν 4 4 (cid:20) (cid:16) (cid:17) (cid:16) (cid:17) 1 1 +2 −c ln −c (8) ν ν 4 4 (cid:16)1 (cid:17) (cid:16) 1(cid:17) + −m +c ln −m +c ν ν ν ν 4 4 (cid:21) (cid:16) (cid:17) (cid:16) (cid:17) while, the entropy contribution given by the interlayer interactions leads to: 1 1 σνν′6=ν = kB + (mν +mν′)+cνν′ × 4 2 (cid:20) (cid:16) (cid:17) 1 1 ×ln + (mν +mν′)+cνν′ + 4 2 1(cid:16) 1 (cid:17) + + (mν −mν′)−cνν′ × 4 2 (cid:16) 1 1 (cid:17) ×ln + (mν −mν′)−cνν′ + 4 2 1(cid:16) 1 (cid:17) + − (mν −mν′)−cνν′ × (9) 4 2 (cid:16) 1 1 (cid:17) ×ln − (mν −mν′)−cνν′ + 4 2 1(cid:16) 1 (cid:17) + − (mν +mν′)+cνν′ × 4 2 (cid:16) 1 1 (cid:17) ×ln − (mν +mν′)+cνν′ 4 2 (cid:16) (cid:17) When we consider the quantities σν, σνν, and σνν′6=ν, the factorization of the statistical operator is evident for σν and σννwhile the factorization for σνν′6=ν is not obvious because of the interactions between the sites localized perpendicularly to the monoatomic layers. It is worth-while to notice here that the factorization of the statistical operator is equivalent to the additive character of the entropy. The simplest illustrative example confirming the above statement can be given by the assumption that cνν′6=ν = mνmν′ which leads to the factorized term (9) in a self-consistent way. Taking into account the above assumption we can consider the pair entropy (6) only in the planes, while the entropy contribution due to the nearest neighbouring layers interactions is reduced to the single-site entropy term. Theequilibrium valuesofthelayer dependent magneticorderparametersm areobtained ν by the variational procedure minimizing the free energy (1) with respect to the parameters m . The obtained set of equations can be solved numerically leading to the layer and ν 7 temperature dependent magnetization; i.e. its profile across a film as well as the Curie temperature evaluation. III. NANO-STRUCTURES IN THE VALENTA MODEL Originally introduced for magnetic films, the Valenta model outlined above is now gener- alized for different systems in which their inhomogeneity is taken into account. The Valenta model assumes the infinite dimensionality in the surface plane. In this context we can speak about the nano-dimension only in the direction perpendicular to the surface and multilayers consisted of several monoatomic planes can be considered as nano-objects with restricted dimension inone direction. Wecan, however, introduce oneor two edges inthe surface plane forming terraces, wires or atomic chains, nano-structures homogeneous only in one direction which is in perfect accordance with the original Neel idea of sublattices. We consider now, the example calculations for the systems mentioned above. A. Ferromagnetic multilayers The magnetic properties of multilayer systems consisting of two different kinds of mag- netic films separated by nonmagnetic spacer are widely studied from the experimental as well as theoretical point of view [19, 20, 21, 22, 23]. The ferromagnetism in such systems is usually discussed in terms of the temperature dependent long-range order parameter i.e. the spontaneous magnetization. From such dependence the behaviour of the Curie temperature can be derived and analyzed. It has been theoretically calculated and experimentally shown [14, 19] that for two ferro- magnetic Ni andCo films coupled by the indirect exchange interaction J (via the Cu film inter - Co/Cu/Ni/Cu(100) system) one obtains two different ordering temperatures and we can observe two susceptibility signals [22] one in T and a weaker one in T∗ . Then, we treat C,Co C,Ni the T∗ as a quasi-critical phase transition temperature of the system. It has been also C,Ni shown [24] that such system can exhibits an inverse behaviour. By selecting the appropriate thicknesses of Co, Cu and Ni films, we can observe the lower ordering temperature of Co than the one of Ni. We present here the numerical calculations for these two different experimental situations 8 performedintheframeofRFA[14]. InthiscasetheinternalenergyU isgiveninthefollowing form: U = −N2z0 Jννmνmν ν X −z Jνν′m m 1 ν ν±1 2 ν′∈ν X − (K −λ)m m ν ν ν ν X −γ Hzm (10) ν ν ν X and the entropy S is expressed by equation (2) reduced to its single site representation. z0 and z1 are the numbers of nearest neighbours of a given atom in the same monoatomic layer andintheneighbouringlayersandforfcc(100)structuretheyare,z0 = 4z1 = 4,respectively; Jνν′ represents the exchange integral responsible for the interaction between a given spin and its nearest neighbours in the same magnetic layer (ν = ν′) or in the neighbouring layers (ν′ = ν ±1), the index numbers the monoatomic layers of the thin film (ν = 1,...,n). It is convenient to denote Jνν′ as JNi and JCo for interior Ni and Co layers while for nickel layers which are in direct connection with copper we put an interface exchange coupling Jinterface. Ni The Co/Cu interface is not differentiated because it is approximately compensated by the enhancement of the magnetic moment in the topmost layer facing the vacuum [25] and we take the same values of the exchange integral for all monoatomic layers forming the Co film. The interaction between the Co and Ni films in the Co/Cu/Ni/Cu(100) system takes place via the interlayer exchange coupling J , which depends on the nonmagnetic spacer inter thickness [14]. The anisotropy constant K including volume and the surface anisotropy Ni term, can be distinguished as we did in the case of the exchange coupling, namely in each magneticfilmwehavein-planeanisotropyK andK whileattheinterfaceNi/Cuwehave Ni Co Kinterface. Additionally, in order to take into account the boundary conditions connected Ni with the surfaces state we consider also a perpendicular anisotropy κ which is included S in the parameter λ calculations [14]. The parameter λ appearing in equation (4) is the correlation parameter characteristic for RFA which is independent of (ν) due to symmetry conditions[26]anditisassumedtobehomogeneousinthesample. Thisparameterisentirely determined by the crystallographic structure of the considered sample and it is not the additional parameter of the theory. For its calculation one needs only the values of exchange 9 FIG.1: Thetrilayer systemCo/Cu/Ni/Cu(100) withtheexchange couplings andanisotropies used in the theoretical model. integrals and anisotropy constants mentioned above and of course the crystallographic data connected with the nearest neighbours distribution. According to the above discussion and on the bases of the experimental findings [19] we have chosen the following values for the exchange integrals and anisotropy constants: J = Ni 1.7·10−21J, Jinterface = 0.5J , J = 3·10−21J, J = −1.82·10−23J, K = 0.001·J , Ni Ni Co inter Ni Ni Kinterface = 0.001·Jinterface, K = 0.001·J and κ = −1. Ni Ni Co Co S The schematic view of the discussed multilayer system is presented in Fig. 1. First, we consider the 2ML Co/2ML Cu/4ML Ni/Cu(100). The temperature dependent layer resolved magnetization of this system is shown in Fig. 2a and we can see that for the whole range of temperatures the magnetization of Ni film is much smaller than for Co one, which is caused by the difference in the values of magnetic moments reported for these two materials [19]. If we now select a Co thickness of only 1ML, the ordering temperature of Co is below that of Ni. In Fig. 2b we present the layer-resolved temperature dependent magnetization for the 1ML Co/2ML Cu/4ML Ni/Cu(100) system. It is clearly seen that in this case we observe the quasi-critical temperature for Co layer T∗ and the usual phase transition in the Ni C,Co film transition temperature T∗ . We have, however, to underline that one monoatomic C,Ni layer deposited on the Cu(100) substrate is determined by different physical conditions than the thin Co film containing 2ML on Cu(100). In the case of 1ML Co we cannot speak any more about magnetic moment compensation at surface and interface and we have to take into account the decrease of the magnetic moments at the interface ( 32exchange integral from J = 3·10−21J to J = 1.8·10−21J [25]. Co Co 10