Logout succeed
Logout succeed. See you again!

Expert Opinions and Logarithmic Utility Maximization for Multivariate Stock Returns with Gaussian Drift PDF
Preview Expert Opinions and Logarithmic Utility Maximization for Multivariate Stock Returns with Gaussian Drift
Expert Opinions and Logarithmic Utility Maximization for Multivariate Stock Returns with Gaussian Drift J¨orn Sass∗, Dorothee Westphal†and Ralf Wunderlich‡ March 10, 2016 6 1 0 Abstract 2 This paper investigates optimal trading strategies in a financial market with multidimen- r sional stock returns where the drift is an unobservable multivariate Ornstein-Uhlenbeck pro- a M cess. Information about thedrift is obtained byobserving stock returns and expert opinions. The latter provide unbiased estimates on the current state of the drift at discrete points in 0 time. 1 The optimal trading strategy of investors maximizing expected logarithmic utility of ter- minal wealth depends on the filter which is the conditional expectation of the drift given the ] availableinformation. Westatefilteringequationstodescribeitsdynamicsfordifferentinfor- M mationsettings. BetweenexpertopinionsthisistheKalmanfilter. Theconditionalcovariance P matrices of the filter follow ordinary differential equations of Riccati type. We rely on basic . theoryaboutmatrixRiccatiequationstoinvestigatetheirproperties. Firstly,weconsiderthe n asymptotic behaviour of the covariance matrices for an increasing numberof expert opinions i f on a finite time horizon. Secondly, we state conditions for the convergence of the covariance - matrices on an infinite time horizon with regularly arriving expert opinions. q [ Finally, wederivetheoptimaltradingstrategy ofaninvestor. Theoptimal expectedloga- rithmicutilityofterminalwealth,thevaluefunction,isafunctionaloftheconditionalcovari- 2 ance matrices. Hence, our analysis of the covariance matrices allows us to deduce properties v of thevaluefunction. 5 5 Keywords: Conditional covariance matrix, Ornstein-Uhlenbeck process, partial information, 1 portfolio optimization, unbiased expert opinions 8 2010 Mathematics Subject Classification: Primary 91G10; Secondary 93E11, 93E20. 0 . 1 1 Introduction 0 6 1 Tradingdecisionsinfinancialmarketsarealwaysmadebasedontheoftenverylimitedinformation : on stock developments available to the investors. Such information might comprise former and v i present observed stock returns. Although these returns are influenced by some drift term, there X is always random variation in observed data. For making trading decisions it is however of huge r importancetoknowasmuchaspossibleabouttheunderlyingdrift. Anothersourceofinformation a that investors often rely on when it comes to trading are expert opinions. Experts might have some deeper knowledge about the current developments in the market and are therefore able to give a more or less accurate estimate of drift terms at certain times. The aim of this paper is to investigate optimal portfolio trading strategies in a financial market where the drift of the stock returns is an unobserved Gaussian process. Information about the drift process is obtained from observing stock returns as well as incoming expert opinions that give an unbiased estimate of the ∗DepartmentofMathematics,UniversityofKaiserslautern,P.O.Box3049,67653Kaiserslautern,Germany; E-mail address: [email protected] †DepartmentofMathematics,UniversityofKaiserslautern,P.O.Box3049,67653Kaiserslautern,Germany; E-mail address: [email protected] ‡Mathematical Institute, BrandenburgUniversityofTechnology Cottbus -Senftenberg, Postfach101344, 03013 Cottbus,Germany; E-mail address: [email protected] 1 Expert Opinions for Multivariate Stock Returns current state of the drift at discrete points in time. An investor’s objective is to find a trading strategy that maximizes expected logarithmic utility of her terminal wealth. Without expertopinionsthis isaclassicalutility maximizationproblemunderpartialinforma- tion, meaning that an investor only has the information coming from observing the stock returns andcannotseetheunderlyingstochasticdriftprocessdirectly. Thebestestimateinamean-square sensethenisthefilter. Whileundersuitableintegrabilityassumptionsexistenceofoptimaltrading strategies can be shown, see Bj¨ork, Davis and Land´en [1] and Lakner [13], we need models which allow for finite-dimensional filters to solve the problem completely including the computation of an optimal policy. There are essentially two cases which lead to finite-dimensional filters. Firstly, the drift process can be modeled as an Ornstein-Uhlenbeck process (OUP) as above (including the degenerate case of a static but unobserved random variable), or as a continuous time Markov chain (CTMC). The filters are the well-known Kalman and Wonham filters, respectively, see e.g. Elliott, Aggoun and Moore [6], Liptser and Shiryaev [15]. In these two models the solution of the utility maximization problem is known, see Brendle [3], Lakner [14], Putscho¨gl and Sass [17] and Honda [10], Rieder and B¨auerle [18], Sass and Haussmann [21], respectively. Including unbiasedexpert opinions reduces the variance ofthe filter. The better estimate then improves the expected utility. This can be seen as a continuous-time version of the static Black- Litterman approach which combines an estimate of the asset returns with expert opinions on the performance of the assets, see Black and Litterman [2]. Frey, Gabih and Wunderlich [7, 8] solve thecaseofanunderlyingCTMCwithpowerutility,andGabih,Kondakji,SassandWunderlich[9] forOUPwithlogarithmicutility. As anapproximation,alsoexpertopinionsarrivingcontinuously in time can be introduced. This allows for more explicit solutions for the portfolio optimization problem. Davis and Lleo [5] consider this approach for an underlying OUP, Sass, Seifried and Wunderlich [22] address the CTMC. This papergeneralizesthe results from[9], obtainedfor a marketwith one stock,to a financial market with d > 1 stocks and corresponding expert opinions. The filtering equations we derive are extensions of the one-dimensional case. The portfolio optimization results carry over to the multivariate case as well, see Theorem 5.2. But the convergence results of [9] for the conditional variance have no direct equivalents in the multivariate case, since they require and state very detailed monotonicity properties and bounds. Instead we choose suitable norms, e.g. the spectral norm, and here lie our main contributions. The convergence of the norms of the conditional covariancesforanincreasingnumberofexpertopinionstozerocannowbeshown,seeTheorem3.4. The convergence of the norms for equidistant expert opinions on an infinite time horizon is more delicate, in particular when requiring monotonicity between the expert opinions which reflects the decreasing impact of the expert opinions over time. Here we state several results, showing convergenceunder certainconditions,see e.g.Theorem4.10, as wellas providingcounterexamples if these conditions do not hold. In detail we proceed as follows. In Section 2 we introduce our financial market model. We assume that the drift of the stock returns is a multivariate Ornstein-Uhlenbeck process with dy- namics dµ =α(δ−µ )dt+βdB , t t t where α,β ∈ Rd×d, δ ∈ Rd and B = (B ) is a d-dimensional Brownian motion. The drift t t∈[0,T] cannotbeobservedbytheparticipantsinthemarket. Asidefromthestockprices,furtherestimates on the current state of the drift arrive in form of expert opinions. We introduce the concept of expert opinions and specify different settings of information that is available to an investor. We assume that one investor observes stock returns only, another one only uses expert opinions for making trading decisions. A third investor is assumed to have access to both of these sources of information. The second part of Section 2 states the corresponding filtering equations. These give the dynamics of the filter and of the conditional covariance matrices. In the case of return observationsonly,thefilteristheclassicalKalmanfilter,seeforexampleLiptserandShiryaev[15]. When we include expert opinions we make use of the discrete-time Kalman filter as described in Elliott, Aggoun and Moore [6]. Section 3 analyzes the conditional covariance matrices. In particular, Theorem 3.4 shows the limiting behaviour for an increasing number of expert opinions with some minimal reliability on a finite time horizon. This is a generalization of Proposition 4.3 from Gabih et al. [9]. In Sec- tion 4, we analyze the limiting behaviour of the conditional covariance matrices on an infinite 2 Expert Opinions for Multivariate Stock Returns time horizon with regularly arriving expert opinions. In this context it is important to mention that the conditional covariance matrices for the investor who observes stock returns only and for the investor observing stock returns as well as expert opinions follow a matrix Riccati equation. In contrast to the one-dimensional situation this ordinary differential equation does not have a closed-form solution which makes the analysis harder. It is nevertheless possible to prove some limiting behaviour in these cases by using basic properties of Riccati differential equations as for example provided in Ku˘cera [12], Wonham [26], Bucy [4] and M˚artensson [16]. The properties of the conditional covariance matrices are helpful when looking at the port- folio optimization problem that we address in Section 5. We consider maximization of expected logarithmic utility of terminal wealth. The optimal strategy and value function for the different investors are computed along the lines of Gabih et al. [9]. It turns out that the optimal value is a function of the corresponding conditional covariance matrices. Hence, the remaining part of the section concentrates on proving properties of the value function that can be deduced from properties of the covariance matrices. In Section 6 we provide some simulations of filters and value functions that illustrate our theoretical results. We also take a short look at the concept of efficiency to analyze the value of information obtained from different sources of information. Notation: Throughoutthispaper,whenconsideringsymmetricmatricesAandB ofthe same size, we will write A>B or B 6A if the difference A−B is positive semidefinite. Unless stated otherwise, whenever A is a matrix, kAk denotes the spectral norm of A. For a symmetric positive semidefinite matrix A ∈ Rd×d we call a symmetric positive semidefinite matrix B ∈ Rd×d the square root of A if B2 =A. The square root is unique and will be denoted by A21. 2 Market Model and Filtering Equations 2.1 Financial Market Model LetT >0denoteourfiniteinvestmenthorizon. Weconsiderafilteredprobabilityspace(Ω,G,G,P) where the filtration G=(G ) satisfies the usual conditions. All processes are assumed to be t t∈[0,T] G-adapted. In our financial market model there is one risk-free bond S0 with dynamics dS0 =S0r dt, S0 =1. t t t 0 Here, r = (r ) is some deterministic continuous process. Furthermore, the market allows t t∈[0,T] investments in d risky stocks S1,...,Sd with m dSi =Si µidt+ σijdWj , i=1,...,d, t t t t (cid:18) j=1 (cid:19) X where W = (W ) is an m-dimensional Brownian motion. We assume that the matrix σσT t t∈[0,T] with σ =(σij) is positive definite. i,j Whereas the matrix σ is constant over time, the drift process µ = (µ1,...,µd)T follows the dynamics of a multivariate Ornstein-Uhlenbeck process. More precisely, dµ =α(δ−µ )dt+βdB , t t t where α,β ∈ Rd×d, δ ∈ Rd and B = (B ) is a d-dimensional Brownian motion independent t t∈[0,T] of W. The initial drift µ is multivariate normally distributed, µ ∼ N(m ,Σ ), for some vector 0 0 0 0 m ∈ Rd and covariance matrix Σ ∈ Rd×d which is symmetric and positive semidefinite. We 0 0 assume that µ is independent of B and W. The drift process µ can be written as 0 t µ =δ+e−αt µ −δ+ eαsβdB . t 0 s (cid:18) Z0 (cid:19) The mean m :=E[µ ] and covariance matrix Σ :=cov(µ ) of µ are given by the formulas t t t t t m =δ+e−αt(m −δ), t 0 t Σ =e−αt Σ + eαsββTeαTsds e−αTt. t 0 (cid:18) Z0 (cid:19) 3 Expert Opinions for Multivariate Stock Returns In our model we are interested in estimating the drift µ from observed stock prices Si, i = 1,...,d. Rather than working directly with the stock prices, it will prove easier to work with the stock returns Ri instead, where dSi dRi = t. t Si t The return dynamics can be written as dR = µ dt+σdW . Note that we can write the returns t t t depending on the stock prices as m 1 Ri =logSi+ (σij)2t t t 2 j=1 X whichimplies that the filtrationgeneratedby the stock prices is the same as the one generatedby the return processes. This is why in the following we assume that investors in the market observe stock returns instead of stock prices. In addition to observing stock returns, information on the drift process µ can be drawn from expert opinions that arrive at discrete time points and give an unbiased estimate of the drift. We model these expert opinions by fixing deterministic time points 0 = t < t < ··· < t < T. 0 1 N−1 The expert views at time t are modeled as a random vector Z =(Z1,...,Zd)T with k k k k 1 Zk =µtk +(Γk)2εk wherethematricesΓ ∈Rd×d aresymmetricpositivedefiniteandε =(ε1,...,εd)T. Here,theεi, k k k k k i = 1,...,d, k = 0,...,N −1, are independent identically N(0,1)-distributed random variables. We also assume that the εi are independent from both µ and the Brownian motions W and B. k 0 NotethatZ ismultivariateN(µ ,Γ )-distributedwhichimpliesthatthe expertopinionsgivean k tk k unbiased estimate of the true state of the drift at time t . The matrix Γ is a means of modelling k k the reliability of the expert. Note that in the one-dimensional situation Γ is just the variance of k the expert’s estimate at time t . k Remark 2.1. It is possible to allowrelativeexpertviews,meaning thatanexpertmay alsogivean estimation of the difference of drifts of two stocks at time t . These relative estimations can be k expressed in the form Q =P µ +ξ ∈Rd k k tk k forsomematrixP ∈Rl×d,andsomerandomvariableξ thatismultivariatenormallydistributed k k with expectation zero. Here, l 6 d is the number of estimates an expert makes. The pick matrix P which we assume to have full rank contains information about which stocks are included in k these estimates, see Section 3.1 of Scho¨ttle, Werner and Zagst [23] for a detailed description and an example. Note that since P has full rank there exists some ϕ ∈Rd such that ξ =P ϕ , for k k k k k example ϕ =PT(P PT)−1ξ . Hence, k k k k k Q =P (µ +ϕ ) k k tk k where Z :=µ +ϕ is an absolute expert view about the state of the drift as introduced above, k tk k since ϕ is normally distributed with expectation zero and can therefore be written as (Γ )1/2ε . k k k It remains to describe the information available to an investor. Following Gabih et al. [9], we distinguishfourdifferentinvestorswithcorrespondinginvestorfiltrations. DefineFH =(FH) t t∈[0,T] forH ∈{R,E,C,F}. Thefirstinvestorweconsidercanobservestockreturnsbutnottheincoming expertopinions. Therefore,herfiltrationFR isforeacht∈[0,T]generatedbythereturnprocesses t {Ri | s 6 t,i = 1,...,d}. Another investor cannot observe these stock returns or simply decides s to rely on the expert opinions Z only. Therefore, the corresponding investor filtration FE is k t generated by the expert opinions {Z | t 6 t}. As a combination of the above filtrations, FC k k t is generated by {Ri | s 6 t,i = 1,...,d} ∪ {Z | t 6 t}. This filtration corresponds to an s k k investor who has access to both stock returns and expert opinions as sources of information. For completeness, we also include an investor who can observe the drift process µ itself. In this last case of full information the investor filtration is simply given by FF =G. 4 Expert Opinions for Multivariate Stock Returns 2.2 Filtering Equations Attheendoftheprevioussubsectionwehavedefinedfourinvestorswithaccesstodifferentsources of information. Only the fully informed investor can observe the drift process (µ ) directly. t t∈[0,T] The otherinvestorsdo notobservethe driftbut haveto estimateit fromthe informationavailable to them. Let FH forH ∈{R,E,C}be the underlying investorfiltrationas definedin the previous subsection. In the mean-squaresense,an optimalestimatorfor the driftµ attime t under partial t informationis the conditional expectation µˆH =E[µ |FH]. These estimators are also called filters t t t andtheaimofthissubsectionistofindfilteringequationsdescribingtheirdynamics. Furthermore, we also investigate the conditional covariance matrix γH =E (µ −µˆH)(µ −µˆH)T FH t t t t t t forH ∈{R,E,C}whichisameasurefo(cid:2)rthedistancebetween(cid:12)µ an(cid:3)ditsfilterµˆH giveninformation (cid:12) t t FH. t The investors with partial information cannot observe the drift directly. The only source of information for the first investor we consider are the return processes, meaning that FR is the corresponding investor filtration. Lemma 2.2. The filter µˆR follows the dynamics t dµˆR =α(δ−µˆR)dt+γR(σσT)−1(dR −µˆRdt), t t t t t where γR is the solution of the ordinary differential equation t d γR =−αγR−γRαT +ββT −γR(σσT)−1(γR)T. dt t t t t t The initial values are µˆR =m and γR =Σ . 0 0 0 0 Proof. The dynamicsfollow immediately fromthe well-knownKalmanfilter, seefor exampleThe- orem 10.3 of Liptser and Shiryaev [15]. NotethatγR followsanordinarydifferentialequation,calledRiccatiequation,andishencede- t terministic. By definition, γR is symmetric positive semidefinite. In the one-dimensionalsituation t itispossibletowritedownaclosed-formsolutionoftheordinarydifferentialequationwhichyields an explicit form of γR, see equation (3.3) in Gabih et al. [9]. In the multidimensional case, we do t not have such an explicit form of γR in general. We will make use of basic properties of Riccati t differentialequations that can be found for example in Bucy [4], Ku˘cera[12], M˚artensson[16] and Wonham [26]. As a next step, we consider an investor whose filtration is FE, meaning that she knows the expert’s opinions but does not observe the stock returns. Lemma 2.3. (i) Let t∈[0,T] and denote by k the maximal index j such that t 6t. Then t∈[t ,t ) or in j k k+1 the case k =N −1 we have t∈[t ,T], and it holds that N−1 µˆE =e−α(t−tk)µˆE + I −e−α(t−tk) δ, t tk d t γE =e−α(t−tk) γE +(cid:0) eα(s−tk)ββ(cid:1)TeαT(s−tk)ds e−αT(t−tk). t tk (cid:18) Ztk (cid:19) Here, I denotes the unit matrix in Rd×d. d (ii) At the information dates t , k =0,...,N −1, we get the formulas k µˆE =ΛEµˆE +(I −ΛE)Z , tk k tk− d k k γE =ΛEγE . tk k tk− Here, ΛE =Γ (γE +Γ )−1. We set µˆE =m and γE =Σ . k k tk− k 0− 0 0− 0 5 Expert Opinions for Multivariate Stock Returns Proof. (i) Note that we can write the drift µ at time t as t t µ =δ+e−α(t−tk) µ −δ+ eα(s−tk)βdB . t tk s (cid:18) Ztk (cid:19) Also, there is no incoming information between t and t, so FE =FE. Hence, k t tk µˆE =E[µ |FE]=E[µ |FE] t t t t tk t =E δ+e−α(t−tk) µ −δ+ eα(s−tk)βdB FE tk s tk (cid:20) (cid:16) Ztkt (cid:17)(cid:12)(cid:12) (cid:21) =δ+e−α(t−tk) µˆEtk −δ+E eα(s−tk)βdBs (cid:12)(cid:12) (cid:18) hZtk i(cid:19) =e−α(t−tk)µˆE + I −e−α(t−tk) δ, tk d where we have used that the stochastic in(cid:0)tegral is indep(cid:1)endent of FE and that it has expectation tk zero. For the conditional covariance matrix we get γE =E (µ −µˆE)(µ −µˆE)T FE t t t t t t (cid:2) (cid:12) (cid:3) t =E δ+e−α(t−tk) µ −(cid:12) δ+ eα(s−tk)βdB −µˆE tk s t "(cid:18) (cid:16) Ztk (cid:17) (cid:19) t T · δ+e−α(t−tk) µ −δ+ eα(s−tk)βdB −µˆE FE . tk s t t (cid:18) (cid:16) Ztk (cid:17) (cid:19) (cid:12)(cid:12) # (cid:12) When inserting the formula for µˆEt that was just proven, some terms canc(cid:12)(cid:12)el. The remaining conditional expectation can then be written as t E e−α(t−tk)(µ −µˆE)+e−α(t−tk) eα(s−tk)βdB tk tk s (cid:20)(cid:16) Ztk (cid:17) t T · e−α(t−tk)(µ −µˆE)+e−α(t−tk) eα(s−tk)βdB FE . tk tk s t (cid:16) Ztk (cid:17) (cid:12)(cid:12) (cid:21) (cid:12) The expansion of this product is (cid:12) E e−α(t−tk)(µ −µˆE)(µ −µˆE)Te−αT(t−tk) FE tk tk tk tk t (cid:2) +E e−α(t−tk)(µtk −µˆEtk) teα(s−tk)βd(cid:12)(cid:12)Bs (cid:3)Te−αT(t−tk) FtE (cid:20) t (cid:16)Ztk (cid:17) (cid:12)(cid:12) (cid:21) +E e−α(t−tk) eα(s−tk)βdBs (µtk −µˆEtk)Te−αT(t−tk) (cid:12)(cid:12)FtE +E(cid:2)e−α(t−tk)(cid:16)Ztkteα(s−tk)βdB (cid:17) teα(s−tk)βdB Te−(cid:12)(cid:12)αT(t−(cid:3)tk) FE s s t (cid:20) (cid:16)Ztk (cid:17)(cid:16)Ztk (cid:17) (cid:12)(cid:12) (cid:21) t t T (cid:12) =e−α(t−tk) γE +E eα(s−tk)βdB eα(s−tk)βdB e−αT(t(cid:12)−tk). tk (cid:20)(cid:16)Ztk s(cid:17)(cid:16)Ztk s(cid:17) (cid:21)! In the last step, the mixed terms cancel because of independence. For the remaining expectation we can show that t t T t E eα(s−tk)βdB eα(s−tk)βdB = eα(s−tk)ββTeαT(s−tk)ds s s (cid:20)(cid:16)Ztk (cid:17)(cid:16)Ztk (cid:17) (cid:21) Ztk and the claim follows. (ii) For the update formulas at information dates we interpret the situation as a degenerate discretetimeKalmanfilterwithtimepointst −andt . Fromformulas(5.12)and(5.13)inElliott, k k 6 Expert Opinions for Multivariate Stock Returns Aggoun and Moore [6] we get µˆE =µˆE +γE (γE +Γ )−1(Z −µˆE ) tk tk− tk− tk− k k tk− = I −γE (γE +Γ )−1 µˆE +γE (γE +Γ )−1Z d tk− tk− k tk− tk− tk− k k =(cid:0)ΛEkµˆEtk−+(Id−ΛEk)Zk (cid:1) for the conditional expectation and γE =E[(µ −µˆE)(µ −µˆE)T|FE] tk tk tk tk tk tk =γE −γE (γE +Γ )−1γE tk− tk− tk− k tk− = I −γE (γE +Γ )−1 γE d tk− tk− k tk− =(cid:0)ΛEkγtEk− (cid:1) for the conditional covariance matrix. These are the update formulas for the filter and the condi- tional covariance matrices at information dates. Alternatively, we can also compute the estimator µˆE and its conditional covariance matrix as a Bayesian update of µˆE given the N(µ ,Γ )- tk tk− tk k distributed expert opinion Z , see for example Theorem II.8.2 in Shiryaev [24]. k From the second part of the previous lemma one sees that at the information dates t the k filter µˆE is a weighted mean of the filter µˆE before the update and the expert opinion Z . tk tk− k The corresponding weights depend on the matrix Γ which is the covariance matrix of the expert k opinion. Proposition 2.4. For fixed k ∈{0,...,N −1} it holds γE 6Γ and γE 6γE . tk k tk tk− Proof. Using the update formula for γE and expanding one term by Γ we get the representation tk k γE =Γ (γE +Γ )−1γE tk k tk− k tk− =Γ (γE +Γ )−1(γE +Γ −Γ ) k tk− k tk− k k =Γ −Γ (γE +Γ )−1Γ . k k tk− k k Since (γE +Γ )−1 is symmetric positive definite there exists some matrix A such that (γE + tk− k k tk− Γ )−1 =A AT. Then k k k Γ (γE +Γ )−1Γ =Γ A ATΓ =Γ A (Γ A )T k tk− k k k k k k k k k k by symmetry of Γ . Hence, Γ (γE +Γ )−1Γ is symmetric positive semidefinite which yields k k tk− k k γE 6Γ . Likewise, when adding and subtracting γE instead, tk k tk− γE =Γ (γE +Γ )−1γE tk k tk− k tk− =(Γ +γE −γE )(γE +Γ )−1γE k tk− tk− tk− k tk− =γE −γE (γE +Γ )−1γE . tk− tk− tk− k tk− As above, we can also show that γE (γE + Γ )−1γE is positive semidefinite, hence γE 6 tk− tk− k tk− tk γE . tk− So far, we have considered FR and FE as investor filtrations. A rational investor in a market willhoweveruseallavailableinformation. Sothecasethatwearemostinterestedinistheinvestor filtration FC which includes return observations as well as expert opinions. The formulas for the filter µˆC and the conditional covariancematrices γC can be deduced similarly to the cases of only t t return observations or only expert opinions. Lemma 2.5. 7 Expert Opinions for Multivariate Stock Returns (i) Let t∈[0,T] and denote by k the maximal index j such that t 6t under the convention that j t =T. Then for t∈[t ,t ) it holds N k k+1 dµˆC =α(δ−µˆC)dt+γC(σσT)−1(dR −µˆCdt) t t t t t where γC follows the ordinary differential equation t d γC =−αγC −γCαT +ββT −γC(σσT)−1(γC)T. dt t t t t t The initial values are µˆC and γC, respectively. tk tk (ii) The update formulas at information dates t are k µˆC =ΛCµˆC +(I −ΛC)Z , tk k tk− d k k γC =ΛCγC , tk k tk− where ΛC =Γ (γC +Γ )−1. Here, we set µˆC =m and γC =Σ . k k tk− k 0− 0 0− 0 Proof. (i)Betweentwoinformationdates,noadditionalexpertopinionsarrive. Hence,onlyreturn observations contribute to the filtration, meaning that FC =FC ∨σ(R |t <s6t). Therefore, t tk s k in [t ,t ), k = 0,...,N −2, and in [t ,T] we are in the standard situation of the Kalman k k+1 N−1 filter. The dynamics follow as in Lemma 2.2. (ii) At the information dates t we use, as in the proof of Lemma 2.3, the degenerate discrete k time Kalman filter or a Bayesianupdate formula. The result from Proposition 2.4 can also be stated in an analogue way for the investor who observes stock returns as well as expert opinions. Proposition 2.6. For fixed k ∈{0,...,N −1} it holds γC 6Γ and γC 6γC . tk k tk tk− Proof. The proof uses the update formulas from Lemma 2.5 and works analogously to the proof of Proposition 2.4. For the sake of completeness we consider as a last case the situation of full information, i.e. wheretheinvestorfiltrationisFF =G. Thiscasecorrespondstoaninvestorwhoisabletoobserve the drift process directly. This situation will not occur in practice. We consider it as a reference case however to compare it to the other settings of information. It is clear that in this situation µˆF =E[µ |FF]=µ andγF =E[(µ −µˆF)(µ −µˆF)T|FF]=0 forall t∈[0,T]. Here, 0 denotes t t t t t t t t t t d d the zero matrix in Rd×d. 3 Properties of the Conditional Covariance Matrix We have seen that for any of the cases H ∈{R,E,C,F} the conditional covariance matrix of the filter,γH,isdeterministic. Sinceitgivesinformationaboutthequalityofthefilterasanestimator t for the drift, we are interested in stating some properties of γH. t Assumption 3.1. In Sections 3 and 4, we assume that α is a symmetric positive definite matrix and that ββT is also positive definite. For H ∈{R,E,C,F} one can easily prove that E[µˆH(µˆH)T]=E[µ µT]−γH =Σ +m mT −γH (1) t t t t t t t t t for t∈[0,T]. This equality will be useful for connecting the filter with its covariance matrix. 8 Expert Opinions for Multivariate Stock Returns 3.1 Comparison of Different Investors First, we compare the covariance matrix of an investor who observes both returns and expert opinions with that of an investor who has access to only one of these sources of information. It can be expected that the additional information yields a more precise estimate of the drift µ . t Proposition 3.2. For all t∈[0,T] we have the inequalities γC 6γR and γC 6γE. t t t t Proof. Fix some x ∈ Rd. We use the fact that for any random variable X and σ-algebra H the conditional expectation E[X|H] is the best mean-square estimate for X, meaning that E (X −E[X|H])2 6E (X −Y)2 (cid:2) (cid:3) (cid:2) (cid:3) for all H-measurable random variables Y. Now, xTγCx=xT E (µ −µˆC)(µ −µˆC)T FC x t t t t t t =E xT(cid:2)(µt−µˆCt )(µt−µˆCt )Tx(cid:12) FtC(cid:3) (cid:12) =E(cid:2) xT(µt−µˆCt ) 2 FtC (cid:12)(cid:12) (cid:3) =E(cid:2)(cid:0)xTµt−E[xT(cid:1)µt|(cid:12)(cid:12)FtC](cid:3)2 FtC . Since FR ⊆FC for all t>0, it follows(cid:2)(cid:0) (cid:1) (cid:12)(cid:12) (cid:3) t t E[xTγCx]=E xTµ −E[xTµ |FC] 2 6E xTµ −E[xTµ |FR] 2 =E[xTγRx]. t t t t t t t t We already know that(cid:2)(cid:0)γC and γR are dete(cid:1)rm(cid:3)inisti(cid:2)c(cid:0), hence xTγCx 6 xT(cid:1)γ(cid:3)Rx. The proof of the t t t t second inequality xTγCx6xTγEx goes completely analogously. t t Now that we have derived the filtering equations for the different investors in the market and stated some first properties of the conditional covariance matrices, we take a short look at the dynamics of γH for H ∈{R,E,C} in an example. t Example 3.3. We assume that we have an investment horizon T of one year and equidistant expert opinions each month which corresponds to setting N =12. We consider a financial market with d=3 stocks and m=d. The model parameters for the drift dynamics are 0.11 −0.48 0.65 0.87 −0.53 −0.22 α= −0.48 2.28 −3.06 and β = −0.53 0.87 −0.02 , 0.65 −3.06 4.18 −0.22 −0.02 0.29 and the matrices 0.09 −0.13 0.16 0.16 0.12 0.01 σ = 0.14 0.03 −0.17 and Σ = 0.12 0.19 −0.04 0 0.05 −0.13 −0.06 0.01 −0.04 0.27 arethe volatility matrix of the returns andthe covariancematrix of µ , respectively. The expert’s 0 reliability is given by the covariance matrices 1.14 0.15 0.58 Γ = 0.15 1.67 −0.73 k 0.58 −0.73 2.67 for each k = 0,...,N −1, in particular the covariance matrix of the expert’s estimates does not depend on the current time point. In Figure 1 the spectral norms of γR, γE and γC are plotted against time for the parameters t t t defined above. For the investor who observes stock returns only, one can see that the spectral norm of γR starts in kΣ k and seems to converge to some value for increasing t. Note that the t 0 mapping t 7→ kγRk is not monotone, other than in the one-dimensional situation. When looking t at the investor who observes expert opinions only, one realizes that at each information date, the 9 Expert Opinions for Multivariate Stock Returns norm of γE decreases. This is due to what we have shown in Proposition 2.4. For large k we see t that the norm of γE increases between information dates t and t . The norms of γE and of t k k+1 tk γE approximate some finite value. For the investor who observes stock returns as well as expert tk− opinions we see that the norm of γC always lies below the minimum of the norm of γR and the t t normof γE. As in the case for expert opinions only, the norm decreases at eachinformation date, t seeProposition2.6. Also,thenormsofγC andofγC seemtoconverge,andforallklargeenough tk tk− the norm is strictly increasing in between information dates t and t . k k+1 kγRk 0.4 kγEk kγCk kΣ k→ 0 0.3 0.2 0 0.1 0.2 0.3 0.4 0.5 0.6 0.7 0.8 0.9 1 Figure 1: Development of kγHk for t∈[0,T], H ∈{R,E,C}, in Example 3.3 t 3.2 Asymptotics for an Increasing Number of Expert Opinions We now address the question what happens when the number of dates at which expert opinions arrive goes to infinity. It stands to reason that when increasing the number of expert opinions such that the time between any two information dates goes to zero, we get an arbitrarilyaccurate estimateofthedriftprocessµ,atleastwhenweassumeaminimallevelofreliabilityoftheexperts. ThecorrespondingstatementinafinancialmarketwithonestockisproveninProposition4.3from Gabih et al. [9]. The result in a market with d stocks is formalized in the following theorem. Theorem 3.4. Let 0 = t(N) < t(N) < ··· < t(N) < T be a sequence of partitions of the interval 0 1 N−1 [0,T]. To shorten notation, we will write t(N) =T for all N. Assume that for the mesh size N ∆ = max t(N)−t(N) N k k−1 k=1,...,N (cid:0) (cid:1) (N) we have lim ∆ = 0. Denote by Γ , k = 0,...,N −1, the covariance matrices of the N→∞ N k expert opinions at time t(N), and assume that there exists some C > 0 such that for all N ∈ N, k k =0,...,N −1, it holds kΓ(N)k6C and that Γ(N) =Γ does not depend on N. k 0 0 Then for all u ∈ (0,T] the conditional covariance matrices γE,N and γC,N that correspond to u u these N expert opinions fulfill lim γE,N = lim γC,N =0. u u N→∞ N→∞ (cid:13) (cid:13) (cid:13) (cid:13) Proof. Throughout the proof we write(cid:13)λmax(cid:13)(A) and λ(cid:13)min(A(cid:13)) for the maximal and minimal eigen- valueofanarbitrarysymmetricmatrixA. This iswell-definedsincealleigenvaluesofasymmetric matrix are real-valued. Furthermore, since kAk is the square root of the maximal eigenvalue of ATA,wecanconcludethatforsymmetricpositivesemidefinitematricesAitholdskAk=λ (A). max First, we note that vTγC,Nv γC,N =λ (γC,N)= u u max u vTv (cid:13) (cid:13) (cid:13) (cid:13) 10