Logout succeed
Logout succeed. See you again!

DTIC ADA510614: Extension of an Orographic-drag Parametrization Scheme to Incorporate Orographic Anisotropy and Flow Blocking PDF
Preview DTIC ADA510614: Extension of an Orographic-drag Parametrization Scheme to Incorporate Orographic Anisotropy and Flow Blocking
Q.J.R.Meteorol.Soc.(2005),131,pp.1893–1921 doi:10.1256/qj.04.160 Extensionofan orographic-dragparametrizationschemetoincorporate orographicanisotropyand flowblocking ByYOUNG-JOONKIM∗andJAMESD.DOYLE NavalResearchLaboratory,Monterey,California,USA (Received29October2004;revised8March2005) SUMMARY TheKim–Arakawaorographicgravity-wavedragparametrizationscheme,whichisacomponentoftheUS Navy’sNOGAPSALPHA(NavyOperationalGlobalAtmosphericPredictionSystem,Advanced-LevelPhysics andHighAltitude),isextendedtoincludetheeffectsoforographicanisotropyandlow-levelflowblocking.The algorithms tocalculate theorographic statisticsneeded for theparametrization are alsorevised. The extended schemeisevaluatedagainstmountainwavesexplicitlysimulatedwithCOAMPS(cid:2)†(CoupledOcean/Atmosphere MesoscalePredictionSystem)ofNRL(NavalResearchLaboratory). Mountain-wave simulations over Boulder, Colorado, USA, are used for representing realistic situations of different wave activity including severe downslope windstorms. The simulations are area-averaged and interpolatedtotheverticalgridofNOGAPS,andareusedastheinputtotheextendedKim–Arakawascheme. The scheme is calibrated by comparing the parametrized vertical distribution of the momentum fluxes with the counterpart obtained from the explicit mesoscale simulations. Overall, the calibrated scheme successfully representsthesimulatedmagnitudesandverticaldivergencesofthemomentumfluxes.Aflowregimediagramis constructedutilizingatimeseriesofthesimulationstofurtherevaluatetheparametrization.Therobustnessofthe orographicstatistics,togetherwithanapproximatemethodtoimproveit,arealsoaddressed. KEYWORDS: Blocked-layer drag Explicit gravity-wave simulation Form drag Gravity-wave drag Off-lineevaluation Regimediagram Wavebreaking 1. INTRODUCTION The effects of orography can be represented by various means in large-scale models of the atmosphere, and their inclusion is crucial for successful simulation and forecast of weather and climate. Ever since the first generation gravity-wave drag (GWD) parametrization schemes based on the theories of two-dimensional (2-D), linear,hydrostatic,stationarymountainwavesoveranidealizedisolatedmountainwere introduced, considerable progress has been made in improving the parametrizations. The most recent examples of such advancement are the inclusion of the effects of orographicanisotropyandlow-levelflowblocking. Until recently, the effects of orography for the stably stratified atmosphere have been treated by separate parametrizations: the ‘breaking’ of unresolved gravity waves launched by subgrid-scale orography as presented by, e.g. Boer et al. (1984), Palmer etal.(1986)andMcFarlane(1987),andthe‘blocking’or‘stagnation’oflow-levelflow through enhanced resolved orography, which increases planetary wave forcing on the large-scaleflow(e.g.Wallaceetal.1983;IwasakiandSumi1986;PalmerandMansfield 1986; Tibaldi 1986). The concept of ‘flow blocking’ was originally introduced into GWD parametrization in the mid 1980s. For a large (inverse) Froude number, Fr ‡, 0 associatedwitharelativelyhighmountain,thelow-levelflowisblockedbythemountain upstream,and the effective mountainheight becomeslowerthan its actualvalue under ∗ Corresponding author: Naval Research Laboratory, Marine Meteorology Division, Stop 2, 7 Grace Hopper Avenue,Monterey,CA93943,USA.e-mail:[email protected] †COAMPSisaregisteredtrademarkoftheNavalResearchLaboratory. ‡TheinverseFroudenumberisdefinedasFr0=hN0/U0,wherehisthemountainheight,andN0andU0arethe Brunt–Va¨isa¨la¨ frequencyandthehorizontalwindmagnitude,respectively,averagedoveradepthwhichdefines lowlevels.ForGWDparametrization,hisusuallydefinedasamultipleofthestandarddeviationoforography, σh,foragridbox. (cid:3)c RoyalMeteorologicalSociety,2005. 1893 Report Documentation Page Form Approved OMB No. 0704-0188 Public reporting burden for the collection of information is estimated to average 1 hour per response, including the time for reviewing instructions, searching existing data sources, gathering and maintaining the data needed, and completing and reviewing the collection of information. Send comments regarding this burden estimate or any other aspect of this collection of information, including suggestions for reducing this burden, to Washington Headquarters Services, Directorate for Information Operations and Reports, 1215 Jefferson Davis Highway, Suite 1204, Arlington VA 22202-4302. Respondents should be aware that notwithstanding any other provision of law, no person shall be subject to a penalty for failing to comply with a collection of information if it does not display a currently valid OMB control number. 1. REPORT DATE 3. DATES COVERED 08 MAR 2005 2. REPORT TYPE 00-00-2005 to 00-00-2005 4. TITLE AND SUBTITLE 5a. CONTRACT NUMBER Extension of an orographic-drag parametrization scheme to incorporate 5b. GRANT NUMBER orographic anisotropy and flow blocking 5c. PROGRAM ELEMENT NUMBER 6. AUTHOR(S) 5d. PROJECT NUMBER 5e. TASK NUMBER 5f. WORK UNIT NUMBER 7. PERFORMING ORGANIZATION NAME(S) AND ADDRESS(ES) 8. PERFORMING ORGANIZATION Naval Research Laboratory,7 Grace Hopper Ave., Stop 2 REPORT NUMBER ,Monterey,CA,93943-5502 9. SPONSORING/MONITORING AGENCY NAME(S) AND ADDRESS(ES) 10. SPONSOR/MONITOR’S ACRONYM(S) 11. SPONSOR/MONITOR’S REPORT NUMBER(S) 12. DISTRIBUTION/AVAILABILITY STATEMENT Approved for public release; distribution unlimited 13. SUPPLEMENTARY NOTES 14. ABSTRACT 15. SUBJECT TERMS 16. SECURITY CLASSIFICATION OF: 17. LIMITATION OF 18. NUMBER 19a. NAME OF ABSTRACT OF PAGES RESPONSIBLE PERSON a. REPORT b. ABSTRACT c. THIS PAGE Same as 29 unclassified unclassified unclassified Report (SAR) Standard Form 298 (Rev. 8-98) Prescribed by ANSI Std Z39-18 1894 Y.-J.KIMandJ.D.DOYLE the 2-D framework (see Fig. 1, reproducedfrom Kim and Arakawa 1994). To account for this effect, Palmer et al. (1986) posed an upper limit on the height (400 m), while Pierrehumbert (1986) used an asymptotic flux function that gives a smooth transition betweentheblockingandnon-blockingstates;seeTable2in KimandArakawa(1995, hereafter KA95) for a list of expressions to treat 2-D flow blocking. This concept of limiting the height of orography upstream was common among the first-generation parametrization schemes before the 3-D nature of orography was fully considered. In other words, the 2-D conceptualization of flow blocking considered only the flow ‘over’themountain,ortheflowbeingblockedcompletelybelowtheflowseparationline thatoccursonthemountain’sflanks,whereasthemorecomplete3-Dconceptualization alsoconsidersalsotheflow‘around’themountainbelowtheseparationline(seeFig.1 ofLottandMiller(1997),hereafterLM97). Surfacefrictionisknowningeneraltoreducemountain-waveamplitudesandwave breakingaloft(e.g.Richardetal.1989;O´lafssonandBougeault1997,hereafterOB97; Doyle et al. 2000; Leutbecher and Volkert 2000; Doyle and Durran 2002; Peng and Thompson 2003). Surface friction can be considered more important than GWD with regardtomomentumexchangewiththesurface(e.g.ShuttsandBroad1993)andisoften enhanced to represent the ‘form drag’ through increased effective surface roughness due to turbulence generated by subgrid-scale orography and vegetation under neutral conditions (e.g. Wood and Mason 1993; Milton and Wilson 1996, hereafter MW96; BelcherandHunt1998;Gregoryetal.1998,hereafterGSM98).Thisformdragconcept has beenextendedto a scalelarger than turbulence,whereit wasoriginally developed, to represent the drag generated by a layer of blocked flow under stable conditions due to flow past subgrid-scale orography (e.g. LM97; Scinocca and McFarlane 2000, hereafterSM00;Websteretal.2003;Zadraetal.2003;Alpert2004;BrownandWebster 2004). As also pointed out by GSM98, the traditional definition of form drag refers to turbulence-scale orographic roughness under neutral or unstable conditions, whereas drag due to flowblocking is to accountfor subgrid-scale(larger thanturbulence-scale) blockingorsplittingofflowunderstableconditions.Inthisstudy,therefore,wereferto the latter processas ‘blocked-layer drag’ (BLD). As a more physicalalternative to the resolved-scaleorographicheightenhancementdiscussedabove,aBLDparametrization isnowimplementedinasubgrid-scalesense,providinganadditionalsourceoflow-level dragunderthe3-Dframework,andisoftenintegratedasapartofGWDparametrization suchasbyLM97andSM00. TheschemeproposedbyKA95parametrizesthedragduetobreakingandtrapping of both hydrostatic and non-hydrostatic gravity waves, and distinguishes between the 2-D flow-blocking ‘upstream’ state and wave breaking ‘downstream’ state based on Pierrehumbert’s (1986) formulations, without incurring drag enhancementdue to flow blocking in the 3-D sense.That is, the blocking due to stagnantflow formed upstream of orography reduces the effective height of orography, resulting in the decrease of drag,whereaslow-levelwavebreaking(LLWB)orlee-wavetrappinginthedownstream region involves a significant increase in drag when certain flow conditions are met (Fig. 1). This scheme collectively treats any enhancement of GWD at low levels due to LLWB or lee-wave trapping in terms of the 2-D resonant amplification of GWD (Peltier and Clark 1979); it is physically similar to that of GSM98, but considers only partial effects of orographic anisotropy through additional orographic statistics. Its implementationsintolarge-scalemodelsarereportedinKim(1996;hereafterK96), Alpertetal.(1996)andalsoKimandHogan(2004). The primary goal of the presentstudy is to extend and evaluatethe KA95 scheme by including 3-D effects of orography and also by including a BLD formulation. EXTENSIONOFOROGRAPHIC-DRAGPARAMETRIZATIONSCHEME 1895 Figure1. Thekeyprocessesthattheorographicgravity-wavedrag(GWD)schemeofKimandArakawa(1995) attemptstoparametrize.Inthedownstreamregion,low-levelwavebreakingand/orwavetrappingofleewavescan contributetoGWD.TheverticaldottedlineisdescribedinappendixA.(TakenfromKimandArakawa(1994).) We introduce a new orographic statistical parameter to consider the effect of oro- graphic anisotropy. We derive the BLD formulation basically following earlier studies by LM97 and SM00, which are based on numerical studies of 3-D flow past isolated mountains(e.g.HuntandSnyder1980;SmolarkiewiczandRotunno1989;Mirandaand James 1992, hereafter MJ92; Scha¨r and Smith 1993; O´lafsson and Bougeault 1996, hereafter OB96; OB97; and Scha¨r and Durran 1997). A rigorous evaluation of the parametrizationwith directmeasurementsisusuallydifficultduetolimited availability and quality of high-resolution observation data. An alternative approach to evaluating the parametrization with observationsis the use of a high-resolution mesoscalemodel, whichhasbeenevaluatedbyvariousmeans,e.g.againstobservationaldataand/orother verifiedmodelsimulations asby, e.g.KA95,Broad (1996),LM97 andGSM98.In this studyweevaluatetheextendedKA95parametrization,hereafterKA95+,usingexplicit simulationsofdrymountainwavesobtainedfroma3-Dmesoscalemodel. In section 2, we present the reformulated versions of orographic statistics origi- nallydevelopedfortheKA95schemeandalsoanewparameterfortakingintoaccount orographic anisotropy. In section 3, we summarize the KA95+ scheme; section 4 presentsanevaluationofthescheme.Wefirstdescribeourmesoscalemodelthatexplic- itlysimulatesmountainwaves,andpresentcase-studiesofthesimulationsrepresenting typical mountain waves. We then evaluate the scheme using the cases by comparing simulated and parametrized results. We construct a regime diagram using all times of the simulations in an effort to further evaluate the scheme. We also discuss important issues regarding the robustness of the orographic statistics and the effects of moisture. ConcludingremarksonremainingissuesoftheKA95+schemeinparticularandthose ofthe GWD parametrization in generalare givenin section5.AppendixA describesa non-localversionoftheparametrizationschemeandappendixBintroducesamethodto obtainweightedaveragesoftheorographicstatistics. 2. STATISTICSOF SUBGRID-SCALE OROGRAPHY FORTHEKA95+SCHEME TheKA95schemerequireshigherorderstatisticsoforographyaswellasthestan- darddeviation(σh)ofsubgrid-scaleorographicheights.Itutilizesthesemi-empiricalbut geophysicalrelationshipsbetweentheconfigurationofsubgrid-scaleorographyandthe physicalcharacteristicsofthecorrespondingflow,whichwereobtainedfromextensive 2-Dmesoscalemountain-wavesimulationsinvolvingover100caseswithvariousshapes andsizesofmountains.Here,wediscusstheseorographicstatistics. 1896 Y.-J.KIMandJ.D.DOYLE (a) Orographicasymmetry Leewavesthataretrappednearthesurfacemaypropagatelaterallytoneighbouring grid cells, and similarly vertically propagating waves may traverse out of the origi- nal model column to neighbouring columns. Thus, GWD originating from a grid cell with orography may even influence a neighbouring cell with flat topography. As the resolution of models increases, this non-local nature of drag becomes more of a criti- cal issue; however,current GWD parametrizations that assumea local column physics framework ignore this effect. This issue was addressed in Kim (1992) by introducing a newparameterwhichconsiderstheeffectofneighbouringgriddomains(appendixA describes this issue further). This approach, however, introduces significant computa- tional inefficiency under current parallel computing architecture due to the need for communicationwithneighbouringgridcells.Therefore,asafirststeptowardaddressing the larger issueofnon-localdrag variance,KA95incorporatedthis effectwithin agrid box,whichisrevisitedhere(formorediscussionseeappendixA). The‘orographicasymmetry’(OA)measurestheasymmetryofsubgrid-scaleorog- raphy and its relative location to the model grid box (see appendix B of KA95 for the originaldefinition).WegeneralizethealgorithmtocalculateOAforanyorographicdata of any resolution, with either fixed intervals for grid point models or variable intervals fortheGaussiangridofspectralmodels: OA≡1−(ND/NU), (1)* where NU and ND denote, respectively, the numbers of subgrid-scale high-resolution orographic elevations in the upstream and downstream regions (relative to the wind direction) higher than the grid-box average of the orographic heights (which is a good approximation for high resolutions to the ‘mode’ used in K96, Eq. (B.1)). The calculations of NU and ND for the four representative wind directions (west, south, south-west and north-west) are illustrated in Fig. 2. Depending on the pre-determined directionsofthelow-levelwind(zonal,meridional,ordiagonalineitherdirection),the regionsoftheupstreamanddownstreamareasaredefinedasshowninthefigure.OAis obtainedusingEq.(1)forthefourrepresentativedirections,andOA(east,north,north- eastandsouth-east)=−OA(west,south,south-westandnorth-west),respectively(e.g. OA(east)isidenticalto−OA(west)).Inalarge-scalemodel,OAisselectedateachtime stepdependingonthewinddirection. If the mountain is symmetric and located in the centre of the grid domain, OA is zero. Although the mountain is located in the centre of domain, however,OA becomes positive(negative)ifthemountainisskewedtodownstream(upstream)asillustratedin Figs.3(a)and(b).Thisdesignisbasedonthe2-Dmountain-wavesimulationsbyKA95 and others showingthat steeperslopes on the leeward sides involve stronger nonlinear waves and more likelihood for LLWB and/or non-hydrostatic wave trapping. OA can also distinguish between the two configurations of orography which involve the same mountaininthegrid,butdifferentlocationsrelativetothegrid(seeFigs.3(c)and(d))— onecaseincludingmostlydownstreamofthemountain(OA>0)andtheotherupstream ∗WelimittherangeofOAasinKA95topreventpeculiarlylargevaluesduetoasmallnumberoforographicdata pointsinagridcell,sothat−1(cid:2)OA(cid:2)1,whichistypicallyfoundwithrealorographicdataofanyresolution. Analternativeformulahasbeensuggested(DrN.Wood,personalcommunication),whichdoesnotrequirethe arbitrary limitandensurestheanti-symmetryofOAforoppositewinddirectionsevenwithasmallnumberof orographic datapoints:OA=c(NU−ND)/(NU+ND),wherethecasewithc=3isthenconsistent withthe originaldefinitionofEq.(1). EXTENSIONOFOROGRAPHIC-DRAGPARAMETRIZATIONSCHEME 1897 NU= N + N NU= N + N 11 12 12 22 ND= N + N ND= N + N 21 22 11 21 (a) (b) N N N ND N 11 21 11 21 W NU ND x(cid:39)2 N N N NU N 12 22 12 22 (cid:39)x1 S NW NU= N + (N +N )/2 NU= N + (N +N )/2 12 11 22 11 21 12 ND= N + (N +N )/2 ND= N + (N +N )/2 21 11 22 22 21 12 (c) (d) N11 N21 N11 N21 ND NU NU ND N12 N22 N12 N22 SW Figure 2. Method of dividing a grid box for calculating the numbers of the subgrid-scale orographic height datapointsintheupstream(NU,shaded)anddownstream(ND)regionstobeusedforobtainingtheorographic asymmetry(OA),dependingonthelow-levelwinddirection,i.e.(a)westerly,(b)southerly,(c)south-westerly, and(d)north-westerly. Forthediagonalwinddirections((c)and(d)), twosidesubgridboxesaresummedand halvedtobeusedbothfortheupstreamanddownstreamregions.(ComparewithFig.6.) (a) OA> 0 (b) OA< 0 (cid:159)U (cid:159)U 0 (cid:39)x/2 (cid:39)x 0 (cid:39)x/2 (cid:39)x (c) OA> 0 (d) OA< 0 (cid:159)U (cid:159)U 0 (cid:39)x/2 (cid:39)x 0 (cid:39)x/2 (cid:39)x Figure 3. Illustration of orographic asymmetry (OA) for an isolated mountain sharing the same value of σh (standarddeviationoftopography)inthegriddomainofside-length(cid:3)x.Foramountainthatissymmetricandin thecentre(notshown),OAisdefinedaszero.Althoughthemountainiscentred,ifitisskewedto(a)downstream ((b)upstream)OAis(a)positive((b)negative).Ifthemountainissymmetric,butlocatedtowardthe(c)upwind ((d) downwind) direction OA is (c) positive ((d) negative). Note that 2-D cases are shown here for simplified visualization,buttheactualstatisticsarecalculatedforthegrid-boxarearatherthanforgridlength(cid:3)x. (OA<0). This is also based on results of the simulations by KA95 and others show- ing that downstream regions are more likely to contain stronger LLWB and/or non- hydrostaticwavetrapping.ThetwoidealizedconfigurationsshowninFigs.3(c)and(d) share the same mountain in the same domain and thus are distinguishable not by the valueofσhinthegridbutbythevaluesofOAwithoppositesign.Intheparametrization, alargerOAgenerallycorrespondstoastrongerGWD. 1898 Y.-J.KIMandJ.D.DOYLE (a) OC~ Larger (b) OC~ Smaller (cid:159)U (cid:159)U 0 (cid:39)x/2 (cid:39)x 0 (cid:39)x/2 (cid:39)x Figure4. Illustrationoforographicconvexity(OC)foranidealized,symmetricandisolatedmountaincasein thegrid domainofside-length (cid:3)x. A(a) sharper ((b) duller) mountaincorresponds to(a) larger ((b) smaller) OC.Notethat2-Dcasesareshownhereforsimplifiedvisualization,buttheactualstatisticsarecalculatedforthe grid-boxarearatherthanforthegridlength((cid:3)x). (b) Orographicconvexity The‘orographicconvexity’(OC)representsthesharpness(andslope)ofthemoun- tain(s), which is linked to the characteris(cid:39)ticsof the correspond(cid:39)ingmountainwave.The expressionforOCtakenfromKA95is: (cid:2)Nx OC≡(1/Nxσh4) (hi −h¯)4, (2) i=1 where x represents the horizontal direction, Nx denotes the number of subgrid-scale orographic heightpoints within the large-scale grid, andthe overbardenotesthe large- scale grid average. The sharpness of mountain has been considered earlier in the parametrizationbyPhillips(1984).Ingeneral,asharper(duller)mountainisassociated with larger- (smaller-) amplitude waves (Fig. 4). As shown by KA95, OC is well correlated with the mountain’s ‘vertical aspect ratio’ (height to half-width; see Fig. 16 of KA95) in the case of isolated, symmetric mountains, which characterizes whether the wavesare launchedwith characteristicsofhydrostatic(low verticalaspectratio) or non-hydrostatic(highverticalaspectratio)waves. (c) Non-dimensionaleffectiveorographiclength The ‘effective orographic length’ (Lx) is the subgrid-scale mountain width mea- sured at the critical orographic height (h ), which is integrated over the grid and nor- c malizedbythegridsize(seeFig.5).Lx wasdesignedtocomplementFr0,whichalone cannotaccuratelymeasurethenonlinearityoftheflowovercomplexmountains(KA95), by estimating the bulk volume of subgrid-scale orography that is associated with non- linearity of the flow. Strongly nonlinear flow with larger Fr involves smaller h , and 0 c thuslargerLx.K96usedtheexpression,hc=1116.2−0.878σh,whichwasempirically derived from the 2-D mountain-wave simulations of KA95, to avoid calculating h in c everytimestepusingtheoriginaldefinition,σhFrc/Fr0,whereFrc(≈0.8)isaprescribed criticalFroudenumber.Inthisstudywefurtherassume,basedonsomeearliertests,that the grid-box average of the subgrid-scale orographic heights is a crude approximation totheempiricalvalueofhc andnowusetheaverageincalculatingLx. TheexpressionforLx describedbyKA95isgeneralizedhereas: (cid:2) Lx ≡ Lxi/(cid:3)x =NW/NT. (3) i Here,(cid:3)xisthehorizontalgridsize,NWdenotesthenumberofsubgrid-scaleorographic heights (high-resolution elevation data points) along the centre area with respect to the wind crossing over four one-eighth grid boxes (for the directions west and south; Figs. 6(a) and (b)) or two one-quarter grid boxes (for south-west and north-west; (cid:159) (cid:159) (cid:39) (cid:39) (cid:39) (cid:39) EXTENSIONOFOROGRAPHIC-DRAGPARAMETRIZATIONSCHEME 1899 L L L L X1 X2 X3 X4 h C 0 (cid:39)x/2 (cid:39)x (cid:3) Figure5. Illustrationofthenon-dimensionaleffectiveorographiclength(Lx= iLxi/(cid:3)x),whichisthesum ofthenon-dimensionalizedhorizontallengthsintersectingthesubgrid-scalemountainatthecriticalheight(hc) inthegridoflength(cid:3)x.hcisapproximatedinthisstudybythegrid-box(area)averagedvalueofsubgrid-scale orographicheights.ThevalueofLx iscalculatedforthefourrepresentativelow-levelwinddirections(described inFig.6).Notethathere2-Dcasesareshownforsimplifiedvisualization,buttheactualstatisticsarecalculated forthegrid-boxarearatherthanfor((cid:3)x). NW= N + N NW= N + N 112 121 123 224 + N + N + N + N 212 221 114 213 (a) (b) N N 114 213 N N 112 212 W x(cid:39)2 N N 121 221 N N 123 224 (cid:39)x1 S NW NW= N + N NW= N + N 12 21 11 22 (c) (d) N11 N21 N11 N21 N12 N22 N12 N22 SW Figure6. Methodsofdividingagridboxfor calculatingthenumber ofsubgrid-scale orographic heightdata pointsinthegridboxhigherthanthegridaverage(NW)tobeusedforobtainingtheeffectiveorographiclength, Lx.Thetotalnumberoforographicheightdatapoints(NT),whichisalsoneededtoobtainLx (seeEq.(3)),is countedforthesamesubgrid-scaleboxesasforNW.Dependingonthelow-levelwinddirection,fourone-eighth boxesortwoone-quarterboxes(shaded)areregardedasthecentresectionoftheboxinthedirectionoftheflow. Figs.6(c)and(d)),whicharehigherthanthegridaverage(bothconsideringeffectively the half of the grid box area as shaded in the figure). NT denotes the total number of orographic data points in the grid box. The calculation is performed for the four representative wind directions similarly to that of OA, and Lx (east, north, north-east andsouth-east)=Lx (west,south,south-westandnorth-west),respectively.Inalarge- scalemodel,Lx isselectedateachtimestepdependingonthewinddirection. 1900 Y.-J.KIMandJ.D.DOYLE L x h c U (cid:39)(cid:65) o x L(cid:65) x (cid:39) x Figure7. Illustrationofthelengthofthelarge-scalegrid((cid:3)x)andthesubgrid-scaleeffectiveorographiclength (Lx) in the direction of the low-level wind (U0) for an isolated mountain; also the lengths in the direction perpendicular to the low-level wind ((cid:3)⊥x and L⊥x, respectively). The critical orographic height, hc, which is approximated by the grid mean orographic height in this study, is shown by the dashed line. The orographic direction(OD),definedbyEq.(4),iscalculatedusingLxandL⊥x. (d) Orographicdirection Itisknownthat3-Dspreadingofmountainwavestendstoreducewavemomentum fluxesandGWDabove(e.g.Shutts1998).Itwasreportedthatidealized3-Dorography generates only about the half of the momentum flux in comparison with correspond- ing 2-D orography (Nappo and Chimonas 1992). Orographic anisotropy was earlier includedintheGWDparametrizationsbyBainesandPalmer(1990)andShutts(1990). The KA95 scheme was originally calibrated based on a 2-D framework using simula- tions with a2-D mountain-wavemodel.The3-D effectsoforographywere considered only partially through OA and Lx, which were calculated for the eight representative wind directions as described above. Thus the KA95 scheme did not fully consider the reduction of wave amplitude due to orographic anisotropy. As a result, the low-level Froudenumber(Fr =hN /U ),whichisoneofthemajormeasuresofnonlinearityof 0 0 0 the flow for the parametrization, inherently assumed the mountain of infinite length in thecross-winddirection.Torectifythisdeficiency,weintroduce‘orographicdirection’ (OD)representingtheorographicanisotropy: L⊥ OD≡ x , (4) L x wheresuperscript⊥denotesthecross-winddirection,i.e.L⊥x denotesLx forthedirec- tionperpendiculartothelow-levelwind(seeFig.7).ODisequivalenttothemountain’s ‘horizontal aspect ratio’ (cross-width to along-width) or inverse ‘eccentricity’ (SM00) for a single symmetric mountain, but is defined more generally here as dominant bulk subgrid-scale orography summed over the grid box with respect to the representative winddirections.TheFroudenumberisaccordinglyredefinedas: N Fr ≡h 0OD, (5) 0 U 0 wheretheorographicheight,h,isdefinedas2σh inthisstudy. (e) Orographicstatisticsdatabase The orographic statistics systematically consider the details of subgrid-scale oro- graphy (e.g. shape, size, number, distribution, direction, etc). These statistics are EXTENSIONOFOROGRAPHIC-DRAGPARAMETRIZATIONSCHEME 1901 designedto be calculatedoffline for computationalefficiency.First, OC andσh, which do not depend on the wind direction, are calculated. Then, lookup tables of OA, OD and Lx with respect to the representative four low-level wind directions (west, south, south-westandnorth-west)areconstructed.Forconsistency,theseorographicstatistics derived from the revised algorithms have been compared for the 2-D ridge cases with those from the original algorithms of KA95. When used online in a large-scale model, the parametrization schemefirst determinesthe direction of the low-levelwind ateach time step, and then simply looks up the pre-calculatedtables to find the corresponding orographicstatistics. 3. EXTENSION OFTHE KA95OROGRAPHIC GWD PARAMETRIZATION SCHEME (a) Thegravity-wavedragparametrization The formulations for the GWD parametrization are formally the same as those of KA95 and K96 except that Fr is now multiplied by OD to include the effects of 0 orographicanisotropyasshowninEq.(5).TheGWD(τ)atthereferencelevel(h )is: ref m |U |3 τ =ρ E G 0 , (6) GWD 0 λ N eff 0 Fr2 E ≡(OA+2)CEFr0/Frc, m≡(1+Lx)OA+1, G≡ Fr2+CG0OC−1, (7) 0 whereρisthedensity;N istheBrunt–Va¨isa¨la¨frequency,U isthehorizontalwindspeed projected to the direction of the low-levelwind; E is the ‘enhancementfactor’ applied only at the reference level to represent the nonlinear enhancementof drag by resonant amplification (e.g. Peltier and Clark 1979) in the downstream regions due to LLWB and/or wave trapping, and is controlled by the shape and location of subgrid-scale orographyinthegrid(OA)andthenonlinearityofthegrid-scaleflow(Fr )normalized 0 byitscriticalvalue;misthe‘numberofmountains’,whichestimatesthebulkvolumeof subgrid-scaleorographyassociatedwiththenonlinearityoftheflow(Lx),anddepends alsoontheshapeandlocationofsubgrid-scalemountain(s)relativetothegrid(OA);G is an asymptotic function that provides a smooth transition between 2-D non-blocking and blocking cases as used by Pierrehumbert (1986) and includes the influence of the vertical mountain aspect ratio through OC, empirically applying the original idea by Pierrehumbert (1986; Eq. (3.8)); and λ is the effective grid length, which was set to eff the length of the grid box in K96, but can be used practically as a tuning coefficient. We set CE =0.8 and CG =0.5 as originally calibrated with mesoscale simulations (KA95). The subscript o denotes a low-level average, which in this study is between the surface and 2σh (=h) differing from the original definition in K96 of the depth of the atmospheric boundary layer. The expressions in Eq. (7) were derived semi- empirically basedon physicalconceptsandevaluatedagainstextensive2-D mountain- wavesimulations(KA95). A nonlinear extension of the original Pierrehumbert formulation, m·E, becomes larger as OA increases, in order to be consistent with the simulations of KA95 that indicate downstream regions are more likely to include stronger wave activity, and thusa greaterchancefor drag enhancement.KA95 demonstratedthatm·E accurately represents at low levels (see Figs. 18(c) and 25 of KA95) the vertical gradient of the Scorer parameter (Scorer 1949), which can be approximated as (cid:7)2≈N2/U2 (more rigorous definitions are given by, e.g. KA95 footnote 7, or Nance and Durran (1998)