Logout succeed
Logout succeed. See you again!

Classic & Sports Car PDF
Preview Classic & Sports Car
ON TEST: DONALD HEALEY’S 100S COUPÉ C L A S S IC & S P O R T S C A R D E C E M B The world’s best-selling E R classic car magazine 2 December2015 £4.80 0 1 STRATOS MAGIC! 5 Driving, owning and rallying Lancia’s spectacular 1970s icon L A N C I A S T R A T O S M G K 3 , H e a le y 1 0 0 S c o u p é , P a n t h e MG’s Mille Miglia racer Daytonashootingbrake Alpine’s greatest hits r F e r Ex-EarlHoweK3driven WildestChinettiFerrari A110leadscelebration r a r i D a y t o n a , A lp in e a t 6 0 N O T I D I E 1S T FIRENZE LORO CIUFFENNA CASTELNUOVO BERARDENGA CASTELNUOVO DELL’ ABATE Organised by H A P P Y F E W R A C I N GTM SOME FATHERS, SONS AND FERRARIS Following the great success of the Rallye Père-Fils™ (father & son) in France, HappyFewRacing™ invites you to take part in a brand new event dedicated to Ferrari owners. And like for each event we organise, the programme is built to give time to meet other teams, share very human moments, enjoy the ride of your car on selected routes and fine cuisine. TUSCANY, STARTING FROM FLORENCE ONLY 45 TEAMS ENNOTRWIESINVITED 8-10 JULY 2016 ADMITTED www.RadunoPadreFiglio.com THE Bonhams is pleased to announce that it is now inviting consignments for the annual Bond Street Sale. BOND STREET SALE With only 35 entry slots available and several motor cars already Sunday 6 December 2015 consigned, the annual event is set to be another exciting auction New Bond Street, London from Bonhams record breaking motoring department. Final call for entries 1961 ASTON MARTIN DB4 SERIES II SPORTS SALOON Off ered directly from 50 years in the ownership of former Gentleman £340,000 - 380,000 Racing Driver and Mercedes-Benz connoisseur John Young 1955 MERCEDES-BENZ 300SL GULLWING COUPÉ £1,000,000 - 1,300,000 Single family ownership from new 1937 LAGONDA LG45 RAPIDE £500,000 - 700,000 The fi rst right-hand drive example 1962 AC COBRA ROADSTER £250,000 - 350,000 Rare right-hand drive variant 1965 MASERATI MISTRAL 3.7-LITRE SPYDER The ex-Works Prototype - “The Mule” £450,000 - 550,000 1964 SUNBEAM TIGER LE MANS COUPÉ £300,000 - 400,000 1962/63 FERRARI 250GT SERIES II CABRIOLET ENQUIRIES Coachwork by Pininfarina +44 (0) 20 7468 5801 £1,000,000 - 1,200,000 [email protected] Catalogue +44 (0) 1666 502 200 [email protected] bonhams.com/motorcars Christian Werner 1927 Mercedes Benz 680 S Rennsport Nuerburgring 1927 1937 Mercedes Benz 540 K Spezial Roadster ZweimUEller Restoration Sales Racing Storage Prototypes Tel. 0043/664/516 73 44 [email protected] AUSTRiA WWW.ZWEiMUEllERCARS.CoM THE DECEMBER SALE FERRARI 512 BBI ENQUIRIES £150,000 - 200,000 +44 (0) 20 7468 5801 Collector’s Motor Cars, [email protected] Motorcycles and Automobilia Catalogue Thursday 10 December 2015 +44 (0) 1666 502 200 RAF Museum, London [email protected] Final call for entries 1975 FERRARI 308 GTB 1936 BENTLEY 4¼-LITRE The Ex-Archie Scott, Gerry Ruddock, £100,000 - 120,000 OWEN SEDANCA COUPE Barn Stored Since 1968 Coachwork by Gurney Nutting & Co. 1938 HRG ‘LE MANS’ MODEL £90,000 - 110,000 £30,000 - 40,000 bonhams.com/motorcars THISMONTH December2015•Volume34No9•Onsale5November STAGE SUPERCAR NEWS Editorial 10 Thegallery 12 News&events 14 Yourevents 21 102 Sport 24 Lost&found 28 WedriveLancia’s Dino-enginedrally COMMENT legend,theStratos MickWalsh Fromthecockpit 33 JamesElliott Misfire 35 SimonTaylor Fullthrottle 37 MartinBuckley Backfire 39 Letters 41 REVIEWS Motoringart 44 Books 47 Models 51 Automobilia 53 Classicshrines 55 Nextmonth 57 Subscribe!08448488835 58 FEATURES 160 Rüsselsheimrazzmatazz:glitz 146 Healey’shardtop:thestoryof fromGM’sGermanoutpost averyspecialdevelopmentcar ALanciafortheforest 102 FlatoutinTurin’sWorldChampion Abingdon’smasterpiece 110 MickWalshtakesthewheelofMG’s iconicsupercharged‘six,’theK3 Renaissancestyle 118 ChantillyArts&Elegancerivalsthe world’sgreatestconcoursevents Fromracertoroadcar 124 Thornehitsthetesttrackinthe Alpine-RenaultA110,A310andGTA Daytonashootingbrake 132 ThebizarreFerrariNART-Panther 154 TheDB7putIanCallum’s isdefinitelynotforshrinkingviolets namefirmlyonthemap Caughtoncamera 142 AvisittotheBelgianGPandLeMans in’62ledtoamagnificentscrapbook Donald’sHealey 146 Ontheroadwiththeboss’high-speed express,the100Sfixed-headcoupé Callum’s“callingcard” 154 Thedesigner’smostcelebratedwork Mid-Atlanticgrace 160 Opel’sforgottenCommodoreAand 142 JamesPagedigsintoanevocative RekordCcoupéandcabriolet albumthatbeganwithatriptoSpa 183 LIVINGWITHCLASSICS Ourclassics 170 Specialist: YourclassicsJowettsaloon 177 MelvynRutter Garagegear 181 isaMeccafor Specialist 183 Morganfans BUYINGANDSELLING 177 Auctions 186 Marketplace 196 Bradford’s Buyer’sguideAudiTTMk1 198 119988 BBuyyer’’s gguiddee to IInggollstaddt’’s fineststarsin Casehistories starton209 Porsche-beater,theAAuuddii TTTT Yourclassics deCadenet’sheroes 274 December2015 Classic&SportsCar 9 CLASSIC&SPORTSCAR HAYMARKETCONSUMERMEDIA, TEDDINGTONSTUDIOS,BROOMROAD, TEDDINGTON,MIDDLESEXTW119BE,UK Editorial Editorial02082675399 Subscriptions08448488835 Displayadvertising02082675377 Classifiedadvertising02082675937 Production02082675262 Webwww.classicandsportscar.com [email protected] F or this month’s Lancia Stratos feature, I spoke to Steve Perez EDITORIAL TEL02082675399 about his experiences rallying one. The conversation turned to an FAX02082675318 WEBSITEwww.classicandsportscar.com accident that he suffered in 2013, when, at high speed on a night [email protected] [email protected] [email protected] stage in Dalby, the little Lancia got away from him over some bumps. [email protected] [email protected] The affable Perez is a four-time national champion, but even he admitted [email protected] [email protected] PHOTOGRAPHERJamesMann that the car swapped ends in an instant, before he’d really registered it. [email protected] [email protected] The fact that somebody as talented as him readily confesses that he finds SENIORCONTRIBUTORSJulianBalme,MartinBuckley,JonPressnell [email protected] [email protected] the short-wheelbase Stratos a handful tells you all need to know about its GROUPEDITORINCHIEFSteveCropley SUBSCRIPTIONS on-the-limit characteristics. There is footage of the accident on YouTube, [email protected] OVERSEASTEL+44(0)1795592976USATEL18882015267 but there is also a minute or so of clips showing Perez and co-driver Paul USAE-MAILusaclassic&[email protected] ADVERTISING Spooner on the 2012 Wales Rally GB. It’s this sequence that really gets E-MAILads.C&[email protected] Commercial/display to the heart of the sometimes-wayward but hugely charismatic Lancia’s TEL02082675377 FAX02082675312 Private/classified appeal, its glorious V6 bark echoing around the valleys and forests as TEL02082675937 FAX02082675404 the car flicks one way then the other. It’s a sight and sound that can’t fail GROUPCOMMERCIALDIRECTORBenGuynan HEADOFSALESTahirSaleem SALESTEAMClaireHenderson,NabilaMoughal,MassimoCristallo, to give you goosebumps – rallying’s equivalent of the Matra V12. RezMellar,IsabelleMcKeever SPECIALPROJECTSMANAGERJohnDeverell Driving the featured example – at far more sedate speeds than the PRODUCTION AilsaDonovan(manager),LeeBrister,KevinConroy,AnnaGray, AbbeyGunner likes of Perez, I should add – brought to mind Murray Walker’s USAADVERTISINGOFFICE SharonSpurlin,14215RiverRatRoad,Athens,AL35611 thoughts after his ride in the two-seater McLaren F1 car: “If you ever TEL+19545795280 [email protected] AdvertisementsareacceptedonlyuponHaymarketMediaGroup’s think that life is dull and ordinary, and things are passing you by, you standardTermsofAcceptanceofAdvertising,copiesofwhichare availablefromtheAdvertisingSalesDepartmentofClassic&SportsCar should try this… fabulous.” JAMESPAGE PUBLISHING [email protected] PUBLISHINGTEAMAngelinaThompson(publishingmanager),John Rumble(seniormarketingexecutive),JamieBallantyne(headofnewstrade marketing),NigelDonnelly(productmanager) [email protected] Griffin gets into gear [email protected] Onlineofferings ©2015HaymarketMediaGroupLtd.Reproductioninwholeorpartofanytext, photographorillustrationwithoutthewrittenpermissionofthepublisheris strictlyprohibited.Thepublishermakeseveryefforttoensurethemagazine’s contentsarecorrect,butcanacceptnoresponsibilityforanyeffectsfrom errorsoromissions.Unsolicitedmaterial–includingtransparencies–isused fromtimetotime,butissubmittedentirelyattheowner’sownriskandthe publisheracceptsnoresponsibilityforitslossordamage PRINTEDBYWyndeham(Roche)Ltd COLOURORIGINATIONHaymarketPre-Press Classic&SportsCar,ISSNnumber0263318X,ispublishedmonthlyby HaymarketMediaGroup,TeddingtonStudios,BroomRoad,Teddington TW119BE,UnitedKingdom. TheUSannualsubscriptionpriceis$75.Airfreightandmailinginthe USAbyagentnamedAirBusinessLtd,c/oWorldnetShippingInc,156-15, 146thAvenue,2ndFloor,Jamaica,NY11434,USA.Periodicalspostage paidatJamaicaNY11431.Subscriptionrecordsaremaintainedat HaymarketMediaGroup,TeddingtonStudios,BroomRoad,Teddington TW119BE.AirBusinessLtdisactingasourmailingagent Amongourfreewallpapersthismonthis DistributedintheUKbyFrontlineLtd,MidgateHouse,Midgate, thisstunningphotooftheLanciaStratos Peterborough,CambsPE11TNTEL01733555161FAX01733562788 BACKNUMBERS £6.60,subjecttoavailability TEL08448488835 OVERSEASTEL+44(0)1795592976 [email protected] EDITORIALDIRECTORMarkPayton Thisyear,ImademyfirstvisittoKopHillandwasbowledoverby Keepupwithallthenewsat STRATEGY&PLANNINGDIRECTORBobMcDowell MANAGINGDIRECTORDavidPrasher thequalityoftheentry.Onthefirstday,Iwasapassengerin(and www.classicandsportscar.com CHIEFEXECUTIVEOFFICERKevinCostello laterdrove)PaulClayson’sex-ETCCVauxhallVX4/90.Onthe Sunday,IwasentrustedwiththeHeritageCentre’s30-98,David orfollowuson Kirkebeingonhandtogivetuition.NeverhaveIhadsuchapublic foruminwhichtomakemyfirstfewgearchangesinavintagecar www.facebook.com/CandSCmagazine thatI’dneverdrivenbefore.Havingcrunchedfirsttosecond,then www.twitter.com/CandSCmagazine secondtothird,Ihadtogobackdownthe’boxnearthetopofthe hill.Youwouldn’tbelievethereliefwhenIdiditquicklyandsilently. www.youtube.com/CandSCmagazine Afterabitofpractice,thesecondrunwasagreatimprovement. HaymarketiscertifiedbyBSIto environmentalstandardISO14001 10 Classic&SportsCar December2015