loading

Logout succeed

Logout succeed. See you again!

ebook img

Analysis of Named Entity Recognition and Linking for Tweets PDF

pages35 Pages
release year2014
file size0.36 MB
languageEnglish

Preview Analysis of Named Entity Recognition and Linking for Tweets

Analysis of Named Entity Recognition and Linking for Tweets Leon Derczynskia, Diana Maynarda, Giuseppe Rizzob,d, Marieke van Erpc, Genevieve Gorrella, Rapha¨el Troncyb, Johann Petraka, Kalina Bontchevaa aUniversity of Sheffield, Sheffield, S1 4DP, UK bEURECOM, 06904 Sophia Antipolis, France cVU University Amsterdam, 1081 HV Amsterdam, The Netherlands dUniversita` di Torino, 10124 Turin, Italy Abstract Applyingnaturallanguageprocessingforminingandintelligentinformationac- cess to tweets (a form of microblog) is a challenging, emerging research area. Unlike carefully authored news text and other longer content, tweets pose a number of new challenges, due to their short, noisy, context-dependent, and dynamicnature. Informationextractionfromtweetsistypicallyperformedina pipeline, comprising consecutive stages of language identification, tokenisation, part-of-speechtagging,namedentityrecognitionandentitydisambiguation(e.g. withrespecttoDBpedia). Inthiswork,wedescribeanewTwitterentitydisam- biguationdataset,andconductanempiricalanalysisofnamedentityrecognition and disambiguation, investigating how robust a number of state-of-the-art sys- tems are on such noisy texts, what the main sources of error are, and which problems should be further investigated to improve the state of the art. Keywords: information extraction, named entity recognition, entity disambiguation, microblogs, Twitter 1. Introduction Information Extraction (IE) [1, 2] is a form of natural language analysis, whichtakestextualcontentasinputandextractsfixed-type,unambiguoussnip- petsasoutput. Theextracteddatamaybeuseddirectlyfordisplaytousers(e.g. a list of named entities mentioned in a document), for storing in a database for lateranalysis,orforimprovinginformationsearchandotherinformationaccess tasks. Named Entity Recognition (NER) is one of the key information extraction tasks, which is concerned with identifying names of entities such as people, locations, organisations and products. It is typically broken down into two Email address: [email protected](LeonDerczynski) 1Toappearin“InformationProcessingandManagement”. Preprint submitted to Elsevier October 27, 2014 main phases: entity detection and entity typing (also called classification) [3]. A follow-up step to NER is Named Entity Linking (NEL), which links entity mentions within the same document (also known as entity disambiguation) [4], or in other resources (also known as entity resolution) [5]. Typically, state-of- the-art NER and NEL systems are developed and evaluated on news articles and other carefully written, longer content [6, 5]. In recent years, social media – and microblogging in particular – have es- tablished themselves as high-value, high-volume content, which organisations increasingly wish to analyse automatically. Currently, the leading microblog- ging platform is Twitter, which has around 288 million active users, posting over 500 million tweets a day,2 and has the fastest growing network in terms of active usage.3 Reliable entity recognition and linking of user-generated content is an en- abler for other information extraction tasks (e.g. relation extraction), as well as opinion mining [7], and summarisation [8]. It is relevant in many appli- cation contexts [9], including knowledge management, competitor intelligence, customerrelationmanagement,eBusiness,eScience,eHealth,andeGovernment. Information extraction over microblogs has only recently become an active research topic [10], following early experiments which showed this genre to be extremely challenging for state-of-the-art algorithms [11]. For instance, named entity recognition methods typically have 85-90% accuracy on longer texts, but 30-50% on tweets [12, 13]. First, the shortness of microblogs (maximum 140 characters for tweets) makes them hard to interpret. Consequently, ambiguity is a major problem since semantic annotation methods cannot easily make use of coreference information. Unlike longer news articles, there is a low amount of discourse information per microblog document, and threaded structure is fragmented across multiple documents, flowing in multiple directions. Second, microtexts exhibit much more language variation, tend to be less grammatical than longer posts, contain unorthodox capitalisation, and make frequent use of emoticons, abbreviations and hashtags, which can form an important part of the meaning. To combat these problems, research has focused on microblog- specific information extraction algorithms (e.g. named entity recognition for Twitter using CRFs [12] or hybrid methods [14]). Particular attention is given to microtext normalisation [15], as a way of removing some of the linguistic noise prior to part-of-speech tagging and entity recognition. In light of the above, this paper aims to answer the following research ques- tions: RQ1 How robust are state-of-the-art named entity recognition and linking methods on short and noisy microblog texts? RQ2 What problem areas are there in recognising named entities in microblog posts,andwhatarethemajorcausesoffalsenegativesandfalsepositives? 2http://news.cnet.com/8301-1023 3-57541566-93 /report-twitter-hits-half-a-billion-tweets-a-day 3http://globalwebindex.net/ thinking/ social-platforms-gwi-8-update-decline-of-local-social-media-platforms 2 RQ3 Which problems need to be solved in order to further the state-of-the-art in NER and NEL on this difficult text genre? Our key contributions in this paper are as follows. We report on the con- struction of a new Twitter NEL dataset that remedies some inconsistencies in prior data. As well as evaluating and analysing modern general-purpose sys- tems, we describe and evaluate two domain specific state-of-the-art NER and NEL systems against data from this genre (NERD-ML and YODIE). Also, we conduct an empirical analysis of named entity recognition and linking over this genre and present the results, to aid principled future investigations in this important area. The paper is structured as follows.4 Section 2 evaluates the performance of state-of-the-art named entity recog- nition algorithms, comparing versions customised to the microblog genre to conventional, news-trained systems, and provides error analysis. Section3introducesandevaluatesnamedentitylinking, comparingconven- tional and recent systems and techniques. Sections 2 and 3 answer RQ1. Section 4 examines the performance and errors of recognition and linking systems, makingoverallobservationsaboutthenatureofthetaskinthisgenre. This section addresses RQ2. Section 5 investigates factors external to NER that may affect entity recog- nition performance. It introduces the microblog normalisation task, compares different methods, and measures the impact normalisation has on the accuracy ofinformationextractionfromtweets,andalsoexaminestheimpactthatvarious NLP pipeline configurations have on entity recognition. In Section 6, we discuss the limitations of current approaches, and provide directions for future work. This section forms the answer to RQ3. Inthispaper,wefocusonlyonmicroblogpostsinEnglish,sincefewlinguistic tools have currently been developed for tweets in other languages. 2. Named Entity Recognition Named entity recognition (NER) is a critical IE task, as it identifies which snippets in a text are mentions of entities in the real world. It is a pre-requisite for many other IE tasks, including NEL, coreference resolution, and relation extraction. NER is difficult on user-generated content in general, and in the microblog genre specifically, because of the reduced amount of contextual in- formation in short messages and a lack of curation of content by third parties (e.g. that done by editors for newswire). In this section, we examine some state-of-the-art NER methods, compare their performance on microblog data, and analyse the task of entity recognition in this genre. 4SomepartsofSection3.2,Section5.1,Section5.2andSection5.3appearedinanearlier formin[11]. 3 2.1. Existing NER systems A plethora of named entity recognition techniques and systems is available for general full text (cf. [16, 17, 18]). For Twitter, some approaches have been proposedbuttheyaremostlystillindevelopment,andoftennotfreelyavailable. Intheremainderofthissection,weevaluateandcompareamixtureofTwitter- specific and general purpose NER tools. We want to eliminate the possibility that poor NER on tweets is systematic – that is, related to some particular approach,tool,ortechnology. Tothisend,weevaluateawiderangeoftoolsand describetheiroperation. Itisalsoimportanttoestablishfactorsthatcontribute to making an entity difficult to recognise, and so we use the results of this multilateral comparison in a later analysis For our analyses of generic NER systems, we chose those that take different approaches and are immediately available as open source. The first system we evaluate is ANNIE from GATE version 8 [19], which uses gazetteer-based lookupsandfinitestatemachinestoidentifyandtypenamedentitiesinnewswire text. ThesecondsystemistheStanfordNERsystem[20],whichusesamachine learning-based method to detect named entities, and is distributed with CRF models for English newswire text. Of the NER systems available for Twitter, we chose Ritter et al. [12], who take a pipeline approach performing first tokenisation and POS tagging before using topic models to find named entities, reaching 83.6% F1 measure. In addition to these, we also include a number of commercial and research annotationservices, availableviaWebAPIsandahybridapproach[14], named NERD-ML, tailored for entity recognition of Twitter streams, which unifies the benefits of a crowd entity recognizer through Web entity extractors combined with the linguistic strengths of a machine learning classifier. The commercial and research tools which we evaluate via their Web APIs are Lupedia,5 DBpedia Spotlight,6 TextRazor,7 and Zemanta.8 DB- pedia Spotlight and Zemanta allow users to customize the annotation task, hence we applied the following settings: i) DBpedia Spotlight={confidence=0, support=0, spotter=CoOccurrenceBasedSelector, version=0.6}; ii) Zemanta ={markup limit:10}. 9 TheirevaluationwasperformedusingtheNERDframe- work [21] and the annotation results were harmonized using the NERD ontol- ogy.10 The NERD core ontology provides an easy alignment with the four classes used for this task. The high-performance system reported by Microsoft Research [13] is not available for evaluation, so we could not reproduce these figures. 5http://lupedia.ontotext.com 6http://dbpedia.org/spotlight 7http://www.textrazor.com 8http://www.zemanta.com 9We wanted to include AlchemyAPI, but its terms and conditions prohibit evaluation withoutpermission,andrequestsforpermissionwerenotanswered. 10http://nerd.eurecom.fr/ontology/nerd-v0.5.n3 4 InTable1,wepresentthemaincharacteristicsofthedifferentNERsystems, as well as the NEL systems that will be evaluated in Section 3. 2.2. Comparative Evaluation of Twitter NER We evaluated the tools described above on three available datasets. The first is the corpus of tweets developed by [12]. This corpus consists of 2,400 tweets (comprising 34K tokens) and was randomly sampled. Tweet IDs are not included in this dataset, making it difficult to determine the nature of the sampling,includingtherelevanttimewindow. Examiningdatestampsonimage URLs embedded in the corpus suggest that it was collected during September 2010. The second is the gold standard data created through a Twitter annota- tionexperimentwithcrowdsourcingatUMBC[22](441tweetscomprising7,037 tokens). The third is the dataset developed for the Making Sense of Microposts 2013 Concept Extraction Challenge [10], consisting of a training and test set. Forourevaluations,weusethetestset(4,264tweetscomprising29,089tokens). These datasets are all anachronistic to some degree, making them susceptible toentitydrift, asignificantproblem intweetdatasetsthat wetouch oninmore detail in Section 3.1.1. Strict matching is used to determine scores. Due to the short document lengths, single entity mistakes can lead to large changes in macro-averaged scores, and so we use micro-averaging; that is, scores are cal- culated where each entity has equal weight, instead of weighting at document level. Thesedatasetsusedisparateentityclassificationschemes,whichwemapped to person, location, organisation, and miscellaneous using the mappings shown inTable2. ItalsoneedstobenotedthatthedifferentTwitterNERapproaches that we evaluate and compare are trained and evaluated on small and custom datasets. This complicates carrying out a comparative evaluation and estab- lishing the state-of-the-art in Twitter NER performance. We exclude Ritter’s T-NER system from the Ritter corpus evaluation, as the released version of the system used this data for training and development. 2.3. Results Results on the Ritter dataset are shown in Table 3. We can see that con- ventional tools (i.e., those trained on newswire) perform poorly in this genre, andthusmicroblogdomainadaptationiscrucialforgoodNER.However,when compared to results typically achieved on longer news and blog texts, state-of- the-art in microblog NER is still lacking. Consequently, there is a significant proportion of missed entity mentions and false positives. A confusion matrix at token-level is also included, in Table 4. This gives an indication of the kinds of errors made by a typical NER system when applied to tweets. ThereareanumberofreasonsforthelowresultsofthesystemsontheRitter dataset. Partly, this is due to the varying annotation schemes and corpora on which the systems were trained. The annotation mapping is not perfect: for example,wemappedFacilitytoOrganisation,butsomesystemswillbedesigned 5 ofmte eo pestN tysyd. ANNIEStanfordNERRitteretal.AlchemyAPILupediaGazetteersandCRFCRFMachineLearningGazetteersandFiniteStateMa-ruleschinesEN,FR,DE,RU,ENENEN,FR,DE,IT,EN,FR,ITCN,RO,HIPT,RU,ES,SVnewswirenewswireTwitterUnspecifiedUnspecified74,3or73or10324319 (adapted)MUCCoNLL,ACECoNLL,ACEAlchemyDBpediaJava(GATEmod-JavaPythonWebServiceWebServiceule)GPLv3GPLv2GPLv3Non-CommercialUnknownyesyespartiallynono DBpediaSpotlightTextRazorZemantaYODIENERD-MLGazetteersandMachineLearningMachineLearningSimilarityMetricsSMOandK-NNSimilarityMetricsandNaiveBayesENEN,NL,FR,DE,ENENENIT,PL,PT,RU,ES,SVUnspecifiedUnspecifiedUnspecifiedTwitterTwitter3201,779811,7794 DBpedia,Free-DBpedia,FreebaseFreebaseDBpediaNERDbase,Schema.orgWebServiceWebServiceWebServiceJava(GATEMod-Java,Python,Perl,ule)bashApacheLicense2.0Non-CommercialNon-CommercialGPLv3yesnonoyespartially ofthedifferentNERandNELsystemsthatarecomparedinthispaper.Foreachofthesystemweindicatewhatlanguagesaresupported,whichdomain(ifknown),thenumberofclassestheentitytypesarecategorisedinto,howtheableorforexamplethroughaWebservice),whichlicenseappliestothesystemandwhetherthesystemcanbeadapteLupedia,Saplo,TextrazorandZemantaitisnotpublicwhatalgorithmsandresourcesareusedexactly. FeatureApproach Languages Domain#ClassesTaxonomyType LicenseAdaptable Approach Languages Domain#ClassesTaxonomy Type LicenseAdaptable Keyfeaturesisused,whated(downloadAlchemyAPI, Table1:approachcanbeusthatfor 6 Ritter Stanford and ANNIE company Organisation facility Location geo-loc Location movie Misc musicartist Misc other Misc person Person product Misc sportsteam Organisation tvshow Misc Table 2: Mappings from Ritter entity types to the Stanford and ANNIE named entity cate- gories. Most“musicartist”annotationsreferredtoeithergroupsorwereofindeterminatesize, soMiscwaschosenforthiscategoryinsteadofPersonorOrganisation. Per-entity F1 Overall System Location Misc Org Person P R F1 ANNIE 40.23 0.00 16.00 24.81 36.14 16.29 22.46 DBpediaSpotlight 46.06 6.99 19.44 48.55 34.70 28.35 31.20 Lupedia 41.07 13.91 18.92 25.00 38.85 18.62 25.17 NERD-ML 61.94 23.73 32.73 71.28 52.31 50.69 51.49 Stanford 60.49 25.24 28.57 63.22 59.00 32.00 41.00 Stanford-Twitter 60.87 25.00 26.97 64.00 54.39 44.83 49.15 TextRazor 36.99 12.50 19.33 70.07 36.33 38.84 37.54 Zemanta 44.04 12.05 10.00 35.77 34.94 20.07 25.49 Table 3: Named entity recognition performance over the evaluation partition of the Ritter dataset. Gold Tokens Loc. Misc. Org. Person O Location 65 3 8 5 28 Misc 9 42 14 6 72 Response Organization 5 2 18 2 27 Person 9 6 6 87 34 O 20 25 26 14 8974 Table4: ConfusionmatrixforStanfordNERperformanceovertheevaluationpartitionofthe Ritterdataset. 7 Per-entity F1 Overall System Location Org Person P R F1 ANNIE 24.03 10.08 12.00 22.55 13.44 16.84 DBpediaSpotlight 0.00 0.75 0.77 28.57 0.27 0.53 Lupedia 28.70 19.35 14.21 54.10 12.99 20.95 NERD-ML 43.57 21.45 49.05 51.27 31.02 38.65 RitterT-NER 44.81 14.29 41.04 51.03 26.64 35.00 Stanford 48.58 27.40 43.07 64.22 29.33 40.27 Stanford-Twitter 38.93 30.93 29.55 38.46 26.57 31.43 TextRazor 9.49 13.37 20.58 38.64 9.10 14.73 Zemanta 35.87 14.56 11.05 63.73 12.80 21.31 Table5: NamedentityrecognitionperformanceoverthegoldpartoftheUMBCdataset. Gold Tokens Location Organization Person O Location 68 3 6 152 Response Organization 8 15 10 229 Person 9 7 33 207 O 21 11 21 6150 Table6: ConfusionmatrixforStanfordNERperformanceovertheUMBCdataset. to represent Facility as Location, in some or all cases. Similarly, some systems will consider MusicArtist as a kind of Person, but in our mapping they are Misc, because there are also bands. All this means that, as is common, such a comparison is somewhat imperfect and thus the comparative results are lower thanthoseusuallyreportedinthesystem-specificevaluations. Itshouldalsobe notedthatthisisalsoasingle-annotatorcorpus,whichhasimplicationsforbias that make it hard to discern statistically significant differences in results [23]. Performance over the UMBC data is shown in Tables 5 and 6. Scores here are generally lower than those over the Ritter data. Some were particularly Per-entity F1 Overall System Location Org Person P R F1 ANNIE 47.83 25.67 72.64 65.98 62.07 63.97 DBpediaSpotlight 35.23 27.39 69.11 59.27 50.42 54.49 Lupedia 33.54 21.30 62.14 65.26 39.11 48.91 NERD-ML 64.08 50.36 86.74 79.52 74.97 77.18 RitterT-NER 43.66 13.73 83.78 76.25 65.75 70.61 Stanford 61.84 33.94 84.90 81.12 67.23 73.52 Stanford-Twitter 50.28 41.95 80.00 80.20 63.35 70.78 TextRazor 26.13 28.23 78.70 57.82 66.90 62.03 Zemanta 46.59 6.62 45.71 29.66 27.28 28.42 Table7: NamedentityrecognitionperformanceovertheMSM2013dataset. 8 Gold Tokens Location Misc. Organisation Person O Location 58 3 4 15 53 Misc. 4 40 3 6 167 Response Organisation 12 11 105 20 180 Person 4 4 11 1697 318 O 21 39 40 152 26122 Table 8: Confusion matrix for Stanford NER performance over evaluation part of the MSM2013dataset. low; weattributethistoahighfrequencyofreferencestoverytransiententities such as pop music bands in the corpus. As the corpus was designed for use as a gold standard for measuring worker reliability in crowdsourced annotation, some particularly difficult entities may have been deliberately preferred during dataset construction. The custom-trained Stanford model achieved high scores for identifying Organisation entities again, though interestingly, the standard newswire-trained model had the best overall F1 score. The NERD-ML chain achieved the best recall score, though the fact that this value is only 31.02% indicates how difficult the dataset is. Finally, performance over the MSM2013 dataset is given in Tables 7 and 8. This is also the reason that “MISC” entities are not scored, because no deter- ministic mapping can be made from this entity class to others. The NERD-ML approach had the overall best performance on all three stock entity types, and the Stanford NER system achieved best precision. This particular annotation scenario, of examining only the text part of indi- vidual tweets, is sub-optimal. Microblog users often rely on sources of context outside the current post, assuming that perhaps there is some shared relation- shipbetweenthemandtheiraudience,ortemporalcontextintheformofrecent eventsandrecently-mentionedentities. Lookingatthetextinisolationremoves thiscontext,makingtheentityrecognitionharderthanitwouldbetotheactual intended reader of the message. 2.4. Analysis The kinds of entities encountered in microblog corpora are somewhat differ- entfromthoseintypicaltext. Wesubjectivelyexaminedtheentitiesannotated aspeople, locationsandorganisationsinthemicroblogcorporaandtheCoNLL NER training data [24]. For people, while those mentioned in news are often politicians, business leaders and journalists, tweets talk about sportsmen, ac- tors, TV characters, and names of personal friends. The only common type is celebrities. For locations, news mentions countries, rivers, cities – large objects – and places with administrative function (parliaments, embassies). Tweets on theotherhanddiscussrestaurants,bars,locallandmarks,andsometimescities; therearerarementionsofcountries,oftenrelatingtoanationalsportsteam,or in tweets from news outlets. Finally, for organisations, the news similarly talks 9 Figure1: Sentencecontextsurroundingpersonentitiesinasampleofnewswiretext about organisations that major in terms of value, power or people (public and private companies and government organisations) while tweets discuss bands, internet companies, and sports clubs. Tweets also have a higher incidence of product mentions than the news genre, occurring in around 5% of messages. That the entities occurring in tweets are different from those in newswire makes it hard for systems to tag them correctly. Ratinov and Roth [6] point out that given the huge potential variety in named entity expressions, unless one has excellent generalised models of the context in which entities are men- tioned, itbecomes very difficultto spot previouslyunseen entities. Thisapplies to gazetteer-based approaches in particular, but also to statistical approaches. Twitter is well-known as being a noisy genre, making it hard even for systems withperfectmodelsofentitycontexttorecogniseunseenNEscorrectly. Forex- ample, in newswire, person entities are often mentioned by full name, preceded by a title, constitute the head of a prepositional phrase, or start a sentence, and are always correctly capitalised. They are often followed by a possessive marker or an extended description of the entity (see Figure 1). This kind of linguistic context is well-formed and consistent, possibly having stability bol- stered by journalistic writing guidelines. In contrast, person entities in tweets are apparently stochastically capitalised, short, and occur in a variety of con- texts [25] – including simply as exclamations (see Figure 2). This is a hostile tagging environment, where one will suffer if one expects the cues learned from heavily structured newswire to be present. Recall, precision and F1 on all corpora were markedly lower than the typi- cal 90%-92% seen with newswire text. Incorporating twitter examples into the 10

See more

The list of books you might like