Logout succeed
Logout succeed. See you again!

Amplification in the auditory periphery: the effect of coupling tuning mechanisms PDF
Preview Amplification in the auditory periphery: the effect of coupling tuning mechanisms
APS/123-QED Amplification in the auditory periphery: the effect of coupling tuning mechanisms K.A. Montgomery Mathematics Department, University of Utah, Salt Lake City, UT 84112 M. Silber Department of Engineering Sciences & Applied Mathematics, Northwestern University, Evanston, IL 60208 S.A. Solla Departments of Physics & Astronomy and Physiology, Northwestern University, Evanston, IL 60208 (Dated: February 8, 2008) A mathematical model describing the coupling between two independent amplification mecha- 7 nismsinauditoryhaircellsisproposedandanalyzed. Haircellsarecellsintheinnerearresponsible 0 fortranslatingsound-inducedmechanical stimuliintoanelectrical signal thatcanthenberecorded 0 bytheauditorynerve. Innonmammals,twoseparatemechanismshavebeenpostulatedtocontribute 2 to the amplification and tuning properties of the hair cells. Models of each of these mechanisms n have been shown to be poised near a Hopf bifurcation. Through a weakly nonlinear analysis that a assumesweakperiodicforcing, weakdamping,andweakcoupling,thephysiologically-based models J of the two mechanisms are reduced to a system of two coupled amplitude equations describing the 2 resonantresponse. Thepredictionsthatfollow fromananalysisofthereducedequations,aswellas 1 performance benefitsduetothecoupling of thetwo mechanisms, are discussed and compared with published experimental auditory nervedata. ] S PACSnumbers: 02.30.Oz,87.16.Xa,87.19.Bb P . n i I. INTRODUCTION l n [ Thenaturalenvironmentpresentstheauditorysystemwiththechallengeofrespondingtosoundsovermanyorders 1 of magnitude; the threshold of hearing and the threshold of pain differ by about thirteen orders of magnitude. For v the ear to discriminate between sounds over such a large dynamic range, it is necessary for auditory stimuli to be 2 compressedintoamuchsmaller,moreachievablerangeofphysicalresponses. Thisisaccomplishedthroughanonlinear 2 mechanismin whichsmallamplitude sounds are amplifiedto a greaterextentthan largeramplitude sounds. In order 0 to process complex sound stimuli, it is also necessary for the auditory system to distinguish between the frequency 1 components ofthe stimuli. The ear’samplificationandfrequency discriminationpropertiesare thoughtto be derived 0 7 from a common, metabolically-powered mechanism, the details of which have been the topic of much investigation 0 [1, 2, 3]. / In both mammals and nonmammals, hair cells of the inner ear are responsible for translating sound-induced n i mechanical stimuli into a neurotransmitter signal which induces the firing of the auditory nerve [4, 5]. Each hair l n cell consists of a cell body which is contacted from below by the auditory nerve and a hair bundle consisting of : actin-supported fibers. When sound stimulates the auditory organ, the resulting motion of the hair bundle causes v transductionchannelstobemechanicallypulledopen. Ioniccurrentthenentersthecellbodythroughthetransduction i X channels, thereby depolarizing the cell, and ultimately causing the release of neurotransmitter at the auditory nerve r synapse. a Inmammals,thefrequency-discriminationpropertiesofthebasilarmembrane,themembraneinwhichthehaircells areembedded,contributetotheauditorysystem’scapacitytodistinguishbetweensoundsofdifferentfrequencies. By contrastinnonmammals,thesurfaceinwhichthehaircellsareembeddedlackstuningproperties. Thenonmammalian auditorysystemisthoughttoachieveitsfrequencytuningpropertiesthroughtwodifferentmechanisms,bothintrinsic to the hair cell. The first mechanism involves the mechanical motion of the hair bundle. Experiments indicate that the hair bundle responds actively, with greater energy than provided by the stimulus, if forced near its resonance frequency [6]. Evidence for a second mechanism, referred to as electrical resonance, is provided by the decaying oscillationsthatareobservedinthe membranepotentialofthe cellbody inresponseto constantcurrentinjection[7]. These oscillations indicate that the cell body possesses a preferred response frequency. Dynamical systems methods have proven useful in analyzing the frequency tuning and amplification properties of physiologically-based auditory models. Interestingly, models of both the active motion of the hair bundle and the electrical resonance mechanism have been shown to be poised near a Hopf bifurcation [8, 9]. A Hopf bifurcation is a robust mechanism for generating spontaneous oscillations as a control parameter of a nonlinear system is varied. It occurs when a static equilibrium loses stability via a complex conjugate pair of eigenvalues (of the associated linear stability problem) crossing the imaginary axis in the complex plane with nonzero imaginary part. It has been 2 suggested that the hair cell critically tunes itself so that its parameters are poised just below the bifurcation point, therebymakingthecellsensitivetostimuliattheHopfbifurcationfrequency,withoutcausingspontaneousoscillations [10, 11]. These investigations determine the generic frequency tuning and amplification properties of a periodically- forced system in the vicinity of a Hopf bifurcation; specifically, they analyze the characteristics of solutions that are frequency-lockedtoaweak,additiveresonantforcingterm. SufficientlyclosetotheHopfbifurcationpoint,thesystem is compressively nonlinear: small inputs are amplified to a greater extent than larger ones [10, 11]. Moreover, the compression of the dynamic range is accompanied by frequency tuning, which is sharper for small amplitude inputs than for larger amplitude signals. Previous studies of hair cell amplification models have considered the normal form for a system near a Hopf bifurcation without actually performing the normal form reduction from the physiologically relevant mathematical model. Here, in Appendix II, we reduce the Hudspeth and Lewis model of the electrical tuning mechanism [12, 13] to the normalform for a system near a Hopf bifurcation, thereby determining the numericalvalues of the coefficients of the normal form corresponding to the model and parameters used by Hudspeth and Lewis. We find that the coefficient of the nonlinear term in the normalform has comparable real and imaginary parts; it is not purely real as wasassumedinearlierinvestigations[10,11]. Weshowthataresultofthenonzeroimaginarypartisthattheresponse of the system to resonant forcing may be hysteretic and that the frequency tuning curves are no longer symmetric about the resonance frequency. We further propose a model that describes weak coupling between the hair bundle amplification mechanism and the electrical resonance mechanism. We assume that both oscillation mechanisms are critically tuned to approximately the same resonantfrequency and only weakly damped so that the Hopf bifurcation normalformappliestoeachindependently,i.e. whentheothermechanismissuppressed. Wethenassumeweaklinear couplingofthe mechanisms,anddirectforcingofthe hair bundle ata frequencythatis closeto its naturalfrequency. As in earlier investigations, the analysis focuses on the frequency-locked solutions, and, in particular, on how the magnitude of response grows with the forcing. We find that the combined critically-tuned amplification system, can lead to a response, R, that scales with F1/9, where F is the resonant forcing amplitude, thereby leading to enhanced amplification, R/F, of small signals. We also explore the enhanced frequency-tuning characteristics of the combined mechanical and electrical amplification system, comparing it with those associated with a single tuning mechanism. Ourpaperisorganizedasfollows. InsectionIIweintroducethereducedmathematicalmodel,withthemathematical details of the reduction from the physiologically-detailed models relegated to Appendix II. Section III contains our analysis of the reduced model, focusing particularly on the simpler situation of unidirectional coupling from the hair bundle tuning mechanismtothe electricalresonator. We presentresponse-versus-forcingcurvesthatdemonstratethe transition from a linear response (R F) to a response R F1/9 as the amplitude of the (weak) signal increases. ∝ ∝ We also demonstrate the sharper tuning that is possible with the combined amplification system. Finally, section IV compares our model predictions with published experimental auditory nerve data. II. MODEL Two distinct mechanisms contribute to auditory tuning in nonmammalian vertebrates: an ‘electrical’ resonance arising from an interplay between ionic currents through the cell membrane, and a ‘mechanical’ resonance associated with the active motion of the stereocilia in reponse to stimuli at their resonance frequency. We start our discussion by focusing on the electrical resonance mechanism. The underlying biophysical components have been discussed by HudspethandLewis[12,13],whoperformedasetofexperimentsthatcarefullycharacterizedthedynamicalproperties of the major ion channels on the cell bodies of bullfrog saccular hair cells. On the basis of these experiments, they developed a single compartment model of the hair cell (see Appendix I) using the simplifying assumption that only two major active ion channels, a voltage-gated calcium channel and a calcium-gated potassium channel, contribute to the cell’s dynamical behavior. In this model, the dynamical evolution of the membrane potential V is given by m an equation based on the direct application of Kirchoff’s laws to a circuit that represents the flow of ions across the membrane: dV C m =g m3(V E )+g (O +O )(V E )+g (V E ) I. (1) − m dt Ca m− Ca K(Ca) 2 3 m− K L m− L − Here V is the membrane potential and C is the membrane capacitance per unit area. The voltage-gated calcium m m (Ca) current is represented by g m3(V E ), where g is the maximum Ca conductance per unit area, m is Ca m Ca Ca − the voltage-dependentfraction of open conformationalsubunits in the Ca channels, and E is the reversalpotential Ca for the Ca ion channels. The Ca-gated potassium (K) current is represented by g (O +O )(V E ), where K(Ca) 2 3 m K − g is the maximum K conductance per unit area, (O +O ) is the fraction of K channels in one of their two K(Ca) 2 3 open states, and E is the reversal potential for the K ion channels. The term g (V E ) represents all passive K L m L − 3 −0.042 −0.042 −0.044 −0.044 −0.046 −0.046 Voltage−−0.00.4085 Voltage−−0.00.4085 −0.052 −0.052 −0.054 −0.054 −0.056 −0.056 0 0.05 0.1 0.15 0.2 0.25 0.3 0 0.05 0.1 0.15 0.2 0.25 0.3 t t (a) (b) FIG.1: NumericalsimulationsoftheresponseofthemembranepotentialofahaircellintheHudspethandLewismodel[12,13], to a constant current, I, injected at t = .06. (a) I = 65 pA; (b) I = 95 pA. A Hopf bifurcation occurs at I∗ ≈91.3 pA. The other parameters of theH&L model (15), used in thesimulations, are given in AppendixI. ion channels as a leak conductance g per unit area and a reversalpotential E . The command current I is directly L L injected into the cell body. The formulation of the model involves six additional equations (see Appendix I) that describe the dynamical evolution of the fraction m of open units in the Ca channels, the intracellular concentration of Ca ions close to the cell membrane, and the fraction of Ca-gated K channels in each of their three closed states (C ,C ,C )andtwo openstates(O ,O ). Intheir seminalwork[12, 13], Hudspeth andLewis(H&L) experimentally 0 1 2 2 3 characterized the value of the various parameters that appear in these equations. The H&L model reproduces qualitatively the decaying membrane potential oscillations observed in current-clamp experiments in which a current of constant amplitude I is injected into the cell body [12, 13]. As shown in Figure 1, theresponseofthemembranepotentialtoastepcurrentofamplitudeI dependscruciallyonthevalueoftheinjected current. Forsmallinjectedcurrents,asillustratedinFigure1(a),themembranepotentialexhibitsanoscillatorydecay to a new constant value. For larger current values, as illustrated in Figure 1(b), the membrane potential decays to a newstate thatisoscillatory. This qualitativedifference signalsatransitionbetweenaregimeinwhichthe asymptotic state is a fixed point and a regime in which the asymptotic state is a limit cycle. In the H&L model, this transition occurs by a Hopf bifurcation [9]. A Hopf bifurcation occurs when a fixed point of a system of ODE’s undergoes a change in stability in which a complex conjugate pair of eigenvalues λ, λ passes from the Re(λ)<0 to the Re(λ)>0 side of the imaginary axis in thecomplexplane. Figure2showstheevolutionoftheeigenvaluesoftheH&Lmodellinearizedarounditsfixedpoint, as the input current is increased from 0 and 100 pA. Note that three of the eigenvalues are always real and negative, andone complex conjugate pair remains in the Re(λ)<0 semispace. The leading complex conjugate pair crossesthe ∗ Re(λ) = 0 axis for I 91.3 pA; this is the value of the input current at which the fixed point becomes unstable, ≈ as determined by fixing the parameters of the model at the experimentally–based estimates listed in Hudspeth and Lewis’s originalpaper. Thatthe H&L modelis, forphysiologicallyreasonablevalues ofthe parameters,poisednear a Hopfbifurcationhasprofoundimplicationsforthesignalprocessingcapabilitiesofthemodelledhaircell. Specifically, at the Hopf bifurcation the system is compressively nonlinear, as it exhibits a large amplification of small amplitude inputs and a smaller amplification of large amplitude inputs [10, 11]. Moreover, the resulting compression of the dynamic range is accompanied by a sharp frequency tuning of the response to small amplitude inputs and a broad tuning in the response to large amplitude inputs [10, 11]. Thedynamicalbehaviorofthemodelisasymptoticallydescribedbytheamplitude ofthemodeassociatedwiththe most unstable eigenvector,which is the one associated with the complex conjugate pair of eigenvalues that cross the Re(λ)=0 axis at the Hopf bifurcation. Sufficiently close to the bifurcation, the system can be generically described by a normal form equation [14]: dA =(a+ib)A+(c+id)A2A, (2) dt | | whichcharacterizesthedynamicalevolutionofthecomplexamplitudeAofthemostunstablemode. Inthisequation, the parametera is ameasure ofthe distance to the Hopf bifurcationata=0; a is negativebelow the bifurcationand positive above. The parameter b is the frequency of the system at the bifurcation, and the parameter d measures the shift in preferred frequency as the amplitude of the solution increases, as readily seen by setting A = reiΩt in (2) to establishthat r = a and Ω=b+dr2. The parameterc distinguishes betweensupercritical(c<0)and subcritical −c q 4 1500 1000 500 ) λ ( m 0 I −500 −1000 −1500 −10000 −8000 −6000 −4000 −2000 0 2000 Re(λ) FIG. 2: The eigenvalues of the Hudspeth and Lewis model (15), linearized about its static equilibrium state as described in Appendix II, evolve in the complex plane as I is increased from 0 pA to 100 pA. Solid lines indicate the trajectory of the eigenvalues with increasing I. Otherparameters of theequations are given in AppendixI. (c>0) Hopf bifurcations. We have carried out a standard nonlinear reduction of the H&L model to the normal form (see Appendix II). In the resulting normal form (26), a is proportional to ∆I = (I I∗)/I∗ and c is negative. This reduction thus − establishesthesupercriticalnatureoftheHopfbifurcationintheH&Lmodel. Forthissupercriticalbifurcation,there is a transition from a stable fixed point to a state in which the fixed point becomes unstable and a stable limit cycle exists. Moreover, in the supercritical case, the radius r of the limit cycle grows, with distance past the bifurcation point, with the characteristic scaling r √∆I. ∝ In the current-clampexperiments conducted by Hudspeth and Lewis [12, 13], the currentinjected into the cell was ofconstantamplitude. Incontrast,naturalinputs to the cellaredue to a time-dependent, sound-inducedmechanical displacementofthehairbundle,whichresultsintime-dependentchangesintheconductancethroughthetransduction channels. Because the transduction channels are passive, this time-dependence can be incorporated into the H&L model through the leakage conductance term on the right-hand-side of (1). In the case of a simple time-periodic ∗ conductance, the reduction carried out in Appendix II suggests that for command currents close to I the most important contribution of the time-periodic forcing to the asymptotic dynamics comes from the Fourier component that is closest to the resonance frequency of the system. In the case of a weak periodic signal with frequency close to the resonator’sfrequency, the time-periodic input can be representedas an additive contribution to the amplitude equation, which then takes the form: dA =(a+ib)A+(c+id)A2A+Feiωt. (3) dt | | Due to the time-translation symmetry of the unforced case, we can, without loss of generality, assume that F is real and positive. We note that earlier investigations of (3) in the context of amplification mechanisms in auditory hair cells [10, 11] assumed a real coefficient of the nonlinear term, i.e. they made the nongeneric assumption that d = 0 such that the preferred frequency of the nonlinear oscillator had no amplitude-dependence. We nextconsider the tuning mechanismassociatedwith the mechanicaldeflection ofthe hairbundle. Experiments in which a glass fiber was attached to the hair bundle and used to mechanically stimulate the bundle at a specific frequencyshowedthatthe hairbundlesrespondpreferentiallytostimuliattheir resonancefrequency[6]. Themotion of the hair bundles has been shown to be sensitive to the amount of calcium ion entering the transduction channels [15]. Amodelforhairbundle motionduetocalciumbindingwithinthe stereociliawasproposedbyChoeet al.[8]. In theirmodel,whentransductioncurrententersthehairbundleCaionsattachthemselvestothetransductionchannels atsites withinthe stereocilia;this attachmentcausesanincreaseintension, whichin turncausesthe channelto close [8]. When the transduction channel closes, the Ca ions detach themselves from the binding sites and the channel returns to its regulartension allowingthe cycle to repeatitself. Choe et al. haveshownthat, when the parametersof theirmodelarespecifiedwithinphysiologicallyreasonableranges,themodelisnearaHopfbifurcation. Experimental evidencealsoindicatesthattherelationshipbetweenstimulusmagnitudeandmagnitudeofthehairbundleoscillations 5 obeys the scaling that would be expected for a system tuned near a Hopf bifurcation [16], lending support to our assumptionthatamodeldescribingthehairbundledynamicsispoisednearaHopfbifurcation. Assumingthissecond mechanismis tuned sufficiently close to a Hopfbifurcation, it too canbe reducedto the normalform(2) for asystem near a Hopf bifurcation. It only remains to consider first the manner in which the two tuning mechanisms are coupled in the biological system, and second how this coupling should be represented in the reduced model. One clear source of coupling between the two tuning mechanisms is through the transduction current. The magnitude of the transduction current enteringthroughthestereociliaisdirectlyrelatedtothemagnitudeofdisplacementofthestereocilia. Thisrelationship between displacement and the amount of current entering the cell has been measured indirectly by measuring the change in the receptor potential of the cell in response to stereocilia displacements of different magnitudes [17]. Such experiments indicate that, in absence of stimuli, a small amount of current is flowing into the cell through the stereocilia. Whenthe hairbundleis deflectedinthenegativedirection,awayfromthe talleststereocilia,transduction channels close and the amount of current flowing into the cell decreases. Similarly, when the hair bundle is deflected in the positive direction, the amount of current entering through the transduction channels increases and eventually saturates. For small displacements in the positive direction, the relationship between the displacement of the hair bundle and the change in the receptor potential is approximately linear [17]. As the amplitude of the hair bundle oscillations increases due to stimulation at the stereocilia’s resonance frequency, the amount of current entering the cell body and providing a forcing to the second electrical resonance mechanism increases. This clearly provides a means of coupling from the stereocilia tuning mechanism to the electrical resonance mechanism. There is also evidence for coupling in the reverse direction, from the electrical resonance mechanism to the hair bundle resonance mechanism, in that electrical stimulation of the cell body has been shown to induce displacement of the stereocilia [18, 19, 20, 21, 22]. The exact mechanism for coupling in this direction is less clear. Experimental comparisonsbetweencurrentinjectedintothecellbodyandtheresultingdisplacementofthestereociliaindicatethat the linear approximation is reasonable for small current injections [23]. The presence of coupling in both directions raisesthe questionofwhetherthere areactuallytwoseparatetuning mechanismsorthe stereociliatuning mechanism is simply a manifestation of the electrical tuning mechanism. This question was addressed in experiments in which the cell body was voltage clamped to silence electrical resonance oscillations allowing the motion of the stereocilia to be probed separately [24]. These experiments demonstrate active motion of the stereocilia even in the absence of the electricalresonancemechanism. Electricalresonanceexperiments areoftenperformedby directcurrentinjection, withtransductionchannelsblocked,sotheindependenceoftheelectricalresonancemechanismfromtheactivemotion of the stereocilia was never in question. From the biological evidence, it is reasonable to assume that the coupling between the two mechanisms is linear for sufficiently small forcing. This leads us to a reduced model consisting of two coupled amplitude equations of the form, dA 1 =(a +ib )A +(c +id )A 2A +γ eiψ1A +Feiωt, (4) 1 1 1 1 1 1 1 1 2 dt | | dA 2 =(a +ib )A +(c +id )A 2A +γ eiψ2A . (5) 2 2 2 2 2 2 2 2 1 dt | | In this model, (4) represents the hair bundle resonance mechanism which receives a sound-induced time-dependent forcing ( F) as well as feedback from the electrical resonance mechanism ( A ). Equation (5) represents the 2 ∝ ∝ electricalresonancemechanismwhichreceivesa forcingproportionalto the displacementofthe stereocilia. Note that we allowedfor a phase difference ψ in eachof the coupling terms, with the corresponding parameters γ taken to be j j realandnon-negative. Moreover,wenotethatwhenbothγ andγ arenonzero,thentheHopfbifurcationsthatcause 1 2 spontaneous oscillations in the unforced problem (F = 0) will shift away from a = 0. As detailed mathematically j in Appendix II, the model is valid for the case in which each system is tuned close to the Hopf bifurcation (a j | | sufficiently small), each system is tuned near the resonance frequency (b ω), and the forcing and the coupling are j ≈ weak (F, γ sufficiently small). j We havedeterminedfromHudspeth andLewis’smodel the numericalvaluesofthe coefficients a , b , c , d of(5) 2 2 2 2 for H&L’s physiological parameters. Models also exist for the stereocilia mechanism, so it is possible that the same coefficientsof(4)couldbedeterminedbasedonthesemodels. Performingthesecondreductionhoweverwouldnotbe particularlyusefulinthispaperbecauseouranalysisrequiresthatbothsystemsbetunedclosetothesamefrequency. There are multiple ways to tune the physiological models such that they yield vibrations at a required frequency. Thus, without a very clear idea of the physiologically reasonable method to adjust the model parameters, there is no way to determine a consistent result for the numerical values of the coefficients in the amplitude equation (4). 6 Nonetheless,manyofourconclusionsregardingscalinglawsholdprovidedthattheHopfbifurcationsaresupercritical (i.e. provided c <0), and that our fundamental modeling assumptions are met. j III. ANALYSIS A. Response-Versus-Forcing Relationship Ouranalysisofthereducedmodel,Eqs.(4)-(5),focusesonfrequency-lockedsolutionsoftheformAj =Rjei(ωt+φj), j = 1,2, where R 0 and φ [0,2π) are constants. We wish to determine how the magnitude of the electrical j j ≥ ∈ response, measured by R , scales with the sound-induced mechanical forcing amplitude F. This scaling depends on 2 the proximity to the Hopf bifurcation, captured by the linear damping coefficients a <0 in (4)-(5). It also depends j onhow closelytuned the naturalfrequencies,b , of the nonlinear oscillationmechanisms are to eachother andto the j driving frequency, ω. Substituting Aj =Rjei(ωt+φj) into (4)-(5) yields the following pair of complex-valued algebraic equations defining an implicit relationship between the real quantities F and R : 2 Fe−iφ1 = (a +i(b ω))R (c +id )R3 γ R ei(φ2−φ1+ψ1), (6) − 1 1− 1− 1 1 1− 1 2 γ R ei(φ1−φ2+ψ2) = (a +i(b ω))R (c +id )R3. (7) 2 1 − 2 2− 2− 2 2 2 We can solve (7) for R in terms of R : 1 2 e−i(φ1−φ2+ψ2) R = (a +i(b ω))R +(c +id )R3 . (8) 1 − γ2 (cid:16) 2 2− 2 2 2 2(cid:17) Herewecandeterminethephasedifference(φ φ )bytherequirementthatR berealandnonnegative. Substituting 1 2 1 − this expression into (6), we find F =ei(φ2−ψ2) α R +α R3+α R5+α R7+α R9 , (9) 1 2 3 2 5 2 7 2 9 2 (cid:16) (cid:17) where 1 α γ ei(ψ1+ψ2)+ (a +i(b ω))(a +i(b ω)), 1 1 1 1 2 2 ≡ − γ − − 2 1 1 α (c +id )(a +i(b ω))+ e−2i(φ1−φ2+ψ2)(c +id )(a +i(b ω))3, 3 ≡ γ 2 2 1 1− γ3 1 1 2 2− 2 2 3 α e−2i(φ1−φ2+ψ2)(a +i(b ω))2(c +id )(c +id ), (10) 5 ≡ γ3 2 2− 1 1 2 2 2 3 α e−2i(φ1−φ2+ψ2)(a +i(b ω))(c +id )(c +id )2, 7 ≡ γ3 2 2− 1 1 2 2 2 1 α e−2i(φ1−φ2+ψ2)(c +id )(c +id )3 . 9 ≡ γ3 1 1 2 2 2 Again, the phase φ in (9) is determined by the requirement that the forcing magnitude F be real and non-negative. 2 It immediately follows from the polynomial form of (9) that the response R need not be a single-valued function of 2 F. It also follows that, with increasing forcing, there is a transition from a linear regime, R F, for sufficiently 2 small forcing, to a regime where R F1/9 for larger values of F. However, whether this transit∝ion occurs for small 2 ∝ values of F, for which the model (4)-(5) is valid, depends on both the magnitude of the coupling coefficients γ and j the magnitude of the linear coefficients a +i(b ω). In particular, if we let ǫ= a +i(b ω), then we expect the j j 2 2 − | − | transition to the regime R F1/9 will occur for small F providedthat a +i(b ω)γ2 is at most O(ǫ3), and γ γ3 is at most O(ǫ4). 2 ∝ | 1 1− | 2 1 2 The response vs. forcing characteristics associated with the model (4)-(5) are further explored in Fig. 3. For this figure,weassumesupercriticalHopfbifurcations associatedwiththe mechanicalandelectricalresonancemechanisms sothatc <0inthemodelequations. Withanappropriatere-scalingofamplitudesA ,wemaythenassumec = 1 j j j − forbothj =1andj =2. Ourdirectcalculationofthenormalformcoefficientsin(5)(seeAppendixII),fromtheH&L model,yieldsd /c 1.1. Thusinmanyofournumericalcomputationswesetd = 1.1. Finally,ifwescaletimeby 2 2 2 ≈ − thedimensionedforcingfrequency,wemaytakeω =1inthemodelequations. Fig.3indicatesstablefrequency-locked 7 solutions as solidlines and unstable solutions by dotted lines. The linear stability of the frequency-lockedsolutionsis determinedbysubstitutingthe ansatzAj =Rjei(ωt+φj)(1+zj(t))intoEqs.(4)-(5)andthenlinearizingaboutzj =0. We then find that the perturbations z satisfy the following system of linear differential equations j z˙1 M1 M2 M3 0 z1 z˙1 = M2 M1 0 M3 z1 , (11) z˙ M 0 M M z 2 6 4 5 2 z˙2 0 M6 M5 M4 z2 where z denotes the complex conjugate of z , etc., and 1 1 M a +ib iω+2(c +id )R2 1 ≡ 1 1− 1 1 1 M (c +id )R2 2 ≡ 1 1 1 R M γ 2ei(φ2−φ1+ψ1) (12) 3 1 ≡ R 1 M a +ib iω+2(c +id )R2 4 ≡ 2 2− 2 2 2 M (c +id )R2 5 ≡ 2 2 2 R M γ 1ei(φ1−φ2+ψ2). 6 2 ≡ R 2 The solutionAj =Rjei(ωt+iφj), with Rj and φj satisfying(6)-(7), is stable ifthe eigenvaluesof the matrix associated with the linearized problem (11) all have negative real part. Figure 3(a) demonstrates the predicted transition from linear response to nonlinear response with R F1/9. 2 ∝ Figure 3(b) shows that as the damping in the system increases, larger forcings are necessary to reach this nonlinear regime. Moreover, this plot demonstrates the possibility of hysteresis which can occur when b ω and d have j j − oppositesigns,providedthe dampingisnottoogreat. Figure3(c)showshowthe transitionfromlinearto1/9scaling moves to larger forcing when the detuning b ω is increased; note that in this plot a scaling of R F1/3 is also 2 2 − ∝ evident over an intermediate range of forcings. Changes in the magnitude of the feedback coefficient γ can either 1 enhance or degrade the response, R , depending upon the coupling phases ψ and ψ . Figure 3(d) shows an example 2 1 2 of the change in the response versus forcing relationship as the feedback coefficient, γ , is increased. 1 B. Uniqueness and Stability: Unidirectional Coupling Theproblemofdeterminingtheuniquenessandstabilityofsolutionsisgreatlysimplifiedinthecaseofunidirectional coupling between the mechanical and electrical resonators. In this section we focus our further analysis on the case where the feedback from the electrical resonator to the stereocilia can be neglected, i.e., we focus on the case γ =0 1 in (4). In this unidirectional-coupling case, M =0 in the stability matrix (11), and the linear stability problem simplifies 3 to one of determining the eigenvalues associatedwith the 2 2-blocks on the diagonal. For instance, if we let σ and 1 σ be the eigenvalues associated with the (z˙ , z˙ )-equations×, we find 2 1 1 σ +σ = M +M =2(a +2c R2) (13) 1 2 1 1 1 1 1 σ σ = M 2 M 2 =a2+(b ω)2+4[a c +(b ω)d ]R2+3(c2+d2)R4. 1 2 | 1| −| 2| 1 1− 1 1 1− 1 1 1 1 1 Similar equations for the remaining two eigenvalues, associated with the (z˙ , z˙ )-equations, hold: they are obtained 2 2 from(13)byinterchangingthe1and2subscriptsonitsright-hand-side. Inthe caseofsupercriticalHopfbifurcations (c < 0), and damping of spontaneous oscillations (a < 0), the frequency-locked solutions are stable provided j j M 2 M 2 > 0 and M 2 M 2 > 0. While these conditions hold for sufficiently small and sufficiently large 1 2 4 5 | | −| | | | −| | amplitudes R and R , they may be violated in the intermediate regime if a c +(b ω)d < 0 for either j = 1 or 1 2 j j j j − j =2. Sinceweareinterestedinthecasethata andc arebothnegative,anecessaryconditionforafrequency-locked j j solution to lose stability, with increase in forcing F, is that b ω and d must have opposite signs. To gain some j j insight into this criterion, it is useful to note that the preferred−frequencies, b +d R2 and b +d R2, of each tuning 1 1 1 2 2 2 mechanism, in absence of forcing, are dependent upon response magnitude. If the natural frequency of the cell shifts awayfromtheforcingfrequencywithincreasingresponse([b ω]d >0),thena c +(b ω)d >0andtheentrained j j j j j j − − solution is always stable and unique. Instabilities, and their associated hysteresis in the reponse vs. forcing curves, canonlyoccurintheunidirectionally-coupledcaseifthe preferredfrequencyofatleastoneofthetuning mechanisms 8 0 0 −0.5 −0.5 )2 −1 )2 −1 R Slope=1/9 R ( ( g g o −1.5 o −1.5 l l Increasing Slope=1 −2 −2 Damping −2.5 −2.5 −6 −5 −4 −3 −2 −1 0 −6 −5 −4 −3 −2 −1 0 log(F) log(F) (a) (b) 0 0 −0.5 −0.5 )2 −1 )2 −1 Increasing R R γ g( Increasing b g( 1 o −1.5 2 o −1.5 l l −2 −2 −2.5 −2.5 −8 −6 −4 −2 0 −4 −3 −2 −1 0 log(F) log(F) (c) (d) FIG. 3: Sample log-log plots of response (R2) versus forcing (F) from (9-10), for the system with c1 = c2 = −1 and with varying damping, coupling, and detuning magnitudes. Solid (dotted) lines represent (un)stable frequency-locked so- lutions. (a) Transition from linear response (R2 ∝ F) to nonlinear response with R ∝ F1/9; dashed lines, for compar- ison, have slopes 1 and 1/9 as indicated. Parameters set to a1 = −0.02, a2 = −0.001, b1 − ω = 0, b2 − ω = .01, d1 = −2, d2 = −1.1, γ1 = 0, γ2 = .1, and ψ2 = 0.64π. (b) Response curves obtained with linear damping parameters (a1,a2) = (−.0002,−.0001),(−.0002,−.1),(−.2,−.1); other parameters set at b1−ω = .01, b2−ω = .02, d1 = −6, d2 = −4, γ1 = 0, γ2 = .1, and ψ2 = 0.64π. (c) Response curves obtained with detuning b2−ω = .001,.01,.1; other parameters set at b1−ω =.002, a1 =−.001, a2 =−.002, d1 =−2, d2 =−1.1, γ1 =0, γ2 =.1, and ψ2 =0.64π. (d) Response curves obtained withdifferentbackwardcouplingmagnitudesofγ1 =0,.1,.2,.3,.4;otherparameterssetata1=−0.1a2 =−0.2,b1−ω=0.02, b2−ω=0.01, d1=−1, d2 =−1.1, γ2 =.1, ψ1 =π, ψ2 =0. shifts towards the forcing frequency with increasing response amplitude ((b ω)d < 0). In this case, the system j j − may jump from a small amplitude response to a larger amplitude one with an increase in the forcing. This follows from the observation that the instabilities, if they occur, come in pairs and correspond to saddle-node bifurcations along the solution branches R (F); see Fig. 3(b) for examples. The necessary and sufficient condition for a pair of j saddle-node bifurcations to occur is 3 a c +(b ω)d < (a2+(b ω)2)(c2+d2) , (14) j j j − j −r4 j j − j j forj =1and/orj =2. Note thatthe predictionthathysteresiscanoccurforlargerdetunings isadirectresultofthe dependence of the cell’s preferredfrequency on response amplitude, an effect which was neglected in previous studies for which the imaginary part of the nonlinear coefficient (d ) was neglected [10, 11]. j 9 2 2 2 1 1 1 Increasing R/F)1 0 ILnocuredanseisnsg /F)2 0 Loudness /F)2 0 ILnocuredanseisnsg γg( 2−1 og(R −1 og(R −1 o l l l −2 −2 −2 −3 −3 −3 0 0.5 ω1 1.5 2 0 0.5 ω1 1.5 2 0 0.5 ω1 1.5 2 (a) (b) (c) FIG.4: Amplificationvs. frequencyplotsfrom(8-9). Amplificationwastakentobeγ2R1/F inthesingletuningmechanismcase (a), and R2/F in thedouble-tuning,uni-directionally coupled cases (b-c). Each curverepresents a constant forcing amplitude taken from the set F = 10−3,10−2.5,10−2.0...10−.5 (a) a1 = −.01, b1 = 1, c1 = −1, and d1 = −2, γ2 = .01, ψ2 = 0.64π. (b) a1 = −.01, a2 = −.02, b1 = b2 = 1, c1 = c2 = −1, d1 = −2, d2 = −1.1, γ1 = 0, γ2 = 0.01, ψ2 = 0.64π. (c) a1 = −.01, a2 =−.02, b1 =1, b2 =1.2, c1 =c2 =−1, d1 =−2, d2 =−1.1, γ1=0, γ2=0.01, ψ2 =0.64π. IV. RESULTS AND DISCUSSION We expect that if each independent amplification mechanism is well-tuned to the forcing frequency (b ω 1) j | − |≪ and the damping is small the coupled system will have a greater response than a system with only a single tuning mechanism. From (10) we see that the leading coefficients α for j = 1,...,7 in (9) may decrease in magnitude, j compared to the highest order coefficient α , as the forcing frequency ω approaches the natural frequencies of the 9 tuning mechanisms, b . Figure 4 demonstrates that the amplification, R2, is greatest near the resonantfrequency. It j F also makes a comparison between the tuning curves for the coupled system and the system with one amplification mechanism suppressed. For the latter case we solve (6) for R (ω) with R = 0, and then plot γ R1 as a function 1 2 2 F of frequency, for different values of F; the coupling γ is included so that the same relationship between the hair 2 bundle displacement and the magnitude of the transduction current is assumed in both the single and the coupled tuning models. Each curve in the diagram shows the variation in response with forcing frequency, holding the signal amplitude F constant. Figure 4(a) shows that the broadest tuning curve occurs for the loudest sounds. As the magnitude of the sound decreases, several effects occur: the amplification increases, the frequency tuning becomes sharper, and because d =0 the preferred frequency shifts as the magnitude of the forcing increases. We used d <0 j j 6 for all of the plots, so the preferred frequencies of the oscillation mechanisms decrease as their amplitude increases. This phenomenon in turn leads to a region of bistability for driving frequencies ω < b as described in Section III. j This bistability is the source of the prominent shoulder in the tuning curves that appearsfor ω <1. A comparisonof the height of the peaks in Figure 4(a) and (b), reveals that amplification of on-resonance forcing is enhanced in the coupled system. Also,the frequency tuning curvesare sharperand display a smaller shift in frequency with changing forcing amplitude in the coupled system. Each of these properties would be a potential advantage of the coupled system. If the preferred frequencies of the two mechanisms are not sufficiently well–tuned to each other, then the single resonance peak in Fig. 4(b) may split into two peaks as seen in Fig. 4(c). Thealgebraicrelationshipbetweenthe magnitudeoftheforcingandthemagnitudeoftheresponseofthe electrical resonancemechanismgivenin(9)allowsforexperimentallytestablepredictionstobemade. Inanidealizedsituation, forwhicheachmechanismisperfectlytunedtotheforcingfrequency(b =b =ω)andsituatedattheHopfbifurcation 1 2 (a = a = 0), equation (9) indicates that the response of the electrical resonance mechanism is proportional to 1 2 F19. The exponent, δ, of this response-versus-forcingrelationship, R2 Fδ, provides a measure of the quality of the ∝ amplification;smallamplitudesignalsareamplifiedtoagreaterextentforsmallervaluesofδ. Forasystememploying only a single tuning mechanism, critically tuned to the bifurcation point and forcing frequency, the expected scaling 1 is R F3 [10, 11]. The smaller exponent of δ = 1/9, associated with the well-tuned coupled model, can provide ∝ more powerful amplification (R /F) than a system with an isolated tuning mechanism. In more realistic situations 2 forwhichsomedampingand/ordetuning is present(a <0,b =ω),equation(9)predictsa transitionfromaregime j j 6 inwhichR F forsmallerforcingsandaregimeinwhichR F1/9 forsufficiently largesignals. Bymeasuringthe 2 2 ∝ ∝ responseoftheelectricalresonancemechanismfordifferentamplitudesofsignal,itispossibletoestimateδ,although, depending upon which portion of the response-versus-forcing curve is sampled, different estimates for δ might be obtained experimentally. In comparing the scaling predictions of our model to experiment, we turn to auditory nerve data. Changes in the membrane potential of the hair cell body result in the release of neurotransmitters at the hair cell-auditory nerve synapse. Larger depolarizations result in larger amounts of neurotransmitter release and thus a faster firing rate in 10 the auditory nerve. There is biological evidence that, even for nonresonant stimuli, the firing rate at the auditory nerve is a nonlinear function of the sound stimulus. However, this nonlinearity, which occurs either due to synaptic effects or the relationship between hair bundle displacement and DC receptor potential, is factored out during the data analysis, allowing an estimate of δ to be made (see discussion in [25, 26]). Numerous experiments have been performed in order to estimate the exponent, δ, of the response-versus-forcing relationship from experimental auditory nerve recordings. Table I summarizes some recent measurements of δ taken fromexperimentsinboth mammalsandnonmammals. Ineachcase,δ iscommonly measuredtobe smallerthan1/3. Inmammals, asin nonmammals,twodifferent mechanismshavebeen proposedto explainamplification,the firstdue toactivemotionofouterhaircells[27,28],andthesecondduetothe activemotionofthe hairbundles[6,29,30,31]. While our results do not directly apply to mammalian data, as the coupling of the two active elements may be more complicated [32], it is noteworthy that compression estimates in mammals are similar to those in nonmammals. Table I. Experimental estimates of δ Nonmammals: Owls: between 0.05 and 0.55, with the majority of data points lying between 0.1 and 0.3 [33] Pigeons: between 0.22 and 0.6 [34] Mammals: Guinea-pigs: between 0.2 and 0.25 [25]. Guinea-pigs: approximately 0.6 for two low- frequency (1.8 and 2.7 kHz.) fibers, and approximately 0.1 for medium- (5.5-6.3 kHz) and high-frequency (20.5-23 kHz) fibers. For fibers tuned above 4 kHz, the mean exponent was 0.13 with a standard deviation of 0.04 [35]. Chinchilla: direct basilar membrane measurements yield δ values between 0.2 and 0.7 [36]. The observation of δ values smaller than 1/3 is interesting in that it indicates that the auditory system achieves greater compressions than would be expected from a system with a single tuning mechanism associated with a Hopf bifurcation. Experimental measurements of the forcing-versus-displacement relationship for individual hair bundles satisfy the R F1/3 scalinglawexpected for a systemtunednear a genericHopf bifurcation[10,11]. Becauseeffects ∝ at the synapse are removed during the data analysis, any additional compression must occur due to the interaction with the electrical resonance mechanism. Somemodelshaveexplainedthis increasedcompressionbyassumingwithintheirmodel, thatthe leadingnonlinear terms are higher than cubic (e.g.[37]). We propose that a more physically motivated way of achieving higher order compression would be through the coupling of two systems tuned near a Hopf bifurcation. With the exception of three data points, all δ-values in K¨oppl and Yates’ owl data are greater than .1, with the majority of measurements lying between .1 and .3 [37]. So their data is not inconsistent with what would be expected from a coupled system, which at best produces a δ-value of 1/9. If it is the case that the observed enhanced amplification occurs due to coupling between the two tuning mechanisms, this is an interesting result, because our analysis indicates that the tuning mechanisms must maintain themselves close to the bifurcation point and close to the same frequency for maximum amplification to be observed. It would be interesting both from a biologicaland mathematical perspective to understand how such fine tuning is achieved. Some studies have suggested that stochastic effects may help the system adjust itself to the bifurcation point [38, 39]. Another has suggestedthat with certain assumptions about the evolution of the bifurcation parameter, self-tuning occurs automatically [40]. Biologically, it has been suggested that adjustments in the tension of the hair bundle due to an actin myosin mechanism may act to keep the hair bundle properly tuned [24, 41]. Another prediction of the model is that the response of the electrical resonance mechanism may be hysteretic for sufficientlylargefrequencydetuning. Itisworthnotingthatthisfeaturearisesasadirectresultofshiftinthenatural frequency of the tuning mechanisms with increasing response, a feature that was not taken into account in previous models. It would be interesting if such bistability could be observed in experimental auditory nerve data. Acknowledgments K.A.M. is grateful for fellowship support through NSF-IGERT grant DGE-9987577 and NSF-RTG grant 0354259. M.S. acknowledges support through NSF Grant DMS-0309667. V. APPENDIX I Model Proposed by Hudspeth and Lewis