Logout succeed
Logout succeed. See you again!

Amazonian biodiversity: a view of drug development for Leishmaniasis and malaria PDF
Preview Amazonian biodiversity: a view of drug development for Leishmaniasis and malaria
Universidade de São Paulo Biblioteca Digital da Produção Intelectual - BDPI Departamento de Química - FFCLRP/593 Artigos e Materiais de Revistas Científicas - FFCLRP/593 2009 Amazonian biodiversity: a view of drug development for Leishmaniasis and malaria Journal of the Brazilian Chemical Society, v.20, n.6, p.1011-1023, 2009 http://producao.usp.br/handle/BDPI/6751 Downloaded from: Biblioteca Digital da Produção Intelectual - BDPI, Universidade de São Paulo J. Braz. Chem. Soc., Vol. 20, No. 6, 1011-1023, 2009. Printed in Brazil - ©2009 Sociedade Brasileira de Química 0103 - 5053 $6.00+0.00 R Amazonian Biodiversity: A View of Drug Development for Leishmaniasis and Malaria e v i Leonardo de Azevedo Calderon,a,b Izaltina Silva-Jardim,b Juliana Pavan Zuliani,b Alexandre de Almeida e e w Silva,b,c Pietro Ciancaglini,d Luiz Hildebrando Pereira da Silvab and Rodrigo Guerino Stábeli*,a,b aCentro de Estudos de Biomoléculas Aplicadas a Medicina Prof. Dr. José Roberto Giglio, Núcleo de Saúde, Universidade Federal de Rondônia, BR 364 Km 9.5, 76800-000 Porto Velho-RO, Brazil bInstituto de Pesquisas em Patologias Tropicais de Rondônia, Rua da Beira 7671, BR 364 km 9.5, 76812-245 Porto Velho-RO, Brazil cLaboratório de Bioecologia de Insetos, Departamento de Biologia, Núcleo de Ciência e Tecnologia, Universidade Federal de Rondônia BR 364 Km 9.5, 76800-000 Porto Velho-RO, Brazil dDepartamento de Química, Faculdade de Filosofia Ciências e Letras de Ribeirão Preto, Universidade de São Paulo, 14040-901 São Paulo-SP, Brazil A quimioterapia é o único procedimento farmacológico validado para a terapêutica da leishmaniose e da malária, consideradas doenças negligenciadas para o desenvolvimento de fármacos pelas indústrias farmacêuticas. Com a não renovação medicamentosa, o surgimento de resistência, os efeitos colaterais e o longo período de tratamento indicam a necessidade do desenvolvimento de novos e mais eficientes fármacos. A Floresta Amazônica é a região com a maior biodiversidade do planeta, com uma riqueza de animais e plantas produtoras de moléculas com atividades biológicas relevantes para o desenvolvimento e exploração biotecnológica. Algumas destas moléculas, obtidas de extratos vegetais e de venenos de anuros, apresentam atividade leishmanicida e plasmodicida, o que demonstra o potencial desta biodiversidade para a investigação de novas drogas. A moderna abordagem na pesquisa de novos fármacos envolve a associação de química combinatória, high-throughput screening, bioinformática, interação molecular, cristalografia e o estudo dinâmico de toxicidade sistêmica e celular, que atualmente no Brasil, estão distribuídas em poucos grupos acadêmicos sem a devida associação industrial. Esta deficiência, agregada ao excesso de regulamentação para o acesso ao material biológico, sobretudo, proveniente de unidades de conservação, populações tradicionais e nações indígenas, é um importante entrave para o desenvolvimento deste tipo de pesquisa. A associação de grupos de pesquisa do Brasil, estimulados por políticas governamentais de financiamento acadêmico e industrial, são essenciais para a superação destas dificuldades, de forma que nos próximos anos possam surgir novos produtos para terapia de doenças negligenciadas oriundas da biodiversidade amazônica. Chemotherapy is the only validated therapy for the treatment for the neglected diseases leishmaniasis and malaria. However, the emergence of drug resistance, collateral effects and long- term treatment encourage the development of new and more efficient drugs. The Amazon tropical forest includes the richest areas of biodiversity in the world, including a great number of microbes, plant and animal species that produce a source of interesting biologically active molecules. Several of these molecules, obtained from plant extracts and frog venom have leishmanicidal and plasmodicidal activity, highlighting the potential of this biodiversity for the development of new drugs. In research, modern approaches in new drug development are carried out using combinatorial chemistry, high-throughput screening, bioinformatics, molecular interaction, crystallography and dynamic studies of cellular and systemic toxicity. In Brazil, these techniques are mainly present in only a few academic groups with no efficient connection to industry. The problem associated with over-regulation for accessing the biological material in restricted areas, local populations and indigenous areas places major barriers in the path of research and development of new drugs. Thus, the association of academic research groups in Brazil, encouraged and supported by government and industry, is essential to overcome these major barriers related to the development of new products for treatment of neglected diseases from Amazonian biodiversity in future years. Keywords: Amazonia, biodiversity, leishmaniasis, Leishmania, malaria, Plasmodium, drug development *e-mail: [email protected] 1012 Amazonian Biodiversity: A View of Drug Development for Leishmaniasis and Malaria J. Braz. Chem. Soc. 1. Amazonian Biodiversity Food and Drug Administration (FDA) has approved 1184 new drugs among wich 609 (51.4%) were natural-products- Biological diversity is not evenly distributed across related: 55 of them were natural products, 270 derived the planet. Tropical rainforests of the world are the most from a natural product by semisynthetic modification, 52 species-rich biome, and probably include more than half made by total synthesis were the pharmacophore came of the number of species on earth. Approximately 70% of from a natural product, and 232 were sythetized mimicking the world’s species are distributed in only 12 countries: a natural product.19 Comparisons of the information Australia, Brazil, China, Colombia, Ecuador, India, presented on sources of new drugs from 1981 to 200718,19 Indonesia, Madagascar, Mexico, Peru, and Zaire.1-3 Tropical indicate that almost half of the drugs approved since 1994 forests in the Americas are consistently more species rich are based on natural products. Thirteen natural-product- than those in Africa and Asia.4 As the largest tract of tropical related drugs were approved from 2005 to 200718 and, as rainforest in the Americas, the Amazon tropical forest has pointed out by Butler,18 five of these represented the first unparalleled biodiversity richness, comprising the richest members of new classes of drugs: the peptides exenatide biodiversity area in the world, including a great number and ziconotide, and the small molecules ixabepilone, of microbes and plant and animal species.4-9 Frequently, retapamulin and trabectedin.13 new species are added to a truly huge diversity list. Recent Despite the advantages of natural products and compilations indicate at least 40,000 plant species, 427 past successes, many large pharmaceutical companies mammals, 1294 birds, 378 reptiles, 427 amphibians, and have scaled back the use of natural products in drug around 3,000 fishes have been scientifically classified in discovery screening.13 This has been because of the noted the region.10 disadvantages of their use that include the difficulties It is believed that one third of the world’s species in sourcing and supply, complexities of natural product inhabit the Amazon tropical rainforest, however one of chemistry and the inherent delay of working with them, the great gaps in Amazonian knowledge is the cataloguing together with complications connected to legal regulation and taxonomy of plants.11 Actually it is estimated that the involving intellectual property rights, access to genetic distribution of unknown flora in the Amazon has long resources, traditional knowledge and related benefit been underestimated and that plant biodiversity probably sharing. includes at least 3 times more plant species in the Amazon Complications involving biodiversity’s legal access than are currently known.11 regulations in Brazil today comprise the greatest problem for the scientific and technological development of the 1.1 Biodiversity and drug development national pharmaceutical industry in the country with the greatest biodiversity in the world. Plants offer a vast source of molecules that present According to Harvey,13 although this is a time when different effects in human homeostasis.12 These molecules, pharmaceutical companies cut back on their use of natural called natural products, have been extensively recognized products in drug discovery, there are many promising drug as an important source of most of the active components candidates in the current development pipeline that are in therapeutically effective medicines. One of the reasons of natural origin. Technical drawbacks associated with for this success is, most of the time, natural products are natural products research have been lessened, and there more readily absorbed than synthetic drugs.13 Before the are better opportunities to explore the biological activity advent of high-throughput screening and post-genomic of previously inaccessible sources of natural products. technologies more than 80% of drug substances were With the increasing acceptance that the chemical diversity natural products or inspired by a natural compound.14 of natural products it is essencial to provide core support This fact illustrates the importance of natural products for for the development of new drugs so that in the future human health. there will be further expansion in the use of drugs based Natural products are not always used just as medical on natural products, whether in nature or developed from products but their actions has also helped reveal important chemical libraries. aspect of physiology by interactions with membrane channels, receptors and metabolic pathways.13-16 1.2 Traditional medicine and ethnopharmacology Comparising information available on sources of new drugs from 1981 to 200717,18 has indicated that almost half Traditional medicine is a comprehensive term used of the drugs approved since 1994 are based on natural to refer either to systems such as Chinese medicine, products.13 Between the years of 1981 to 2006, the U. S. Indian ayurveda and Arabic unani medicine, or to various Vol. 20, No. 6, 2009 Calderon et al. 1013 forms used in indigenous and traditional communities. as neglected diseases due to lack of financial investments Traditional medicine is characterized by the use of plants, by the world pharmaceutical industry and, when associated animals and mineral substances by arcaic communities for with HIV co-infection, present a serious public health therapeutical purposes to treat various diseases.20 Studies problem in the majority of the developing countries in of the pharmacological aspects of these medicines by the tropical regions of the world.28 Human malaria is ethnopharmacological approaches reveal several active an infectious disease caused by one or more species of components derived form plants used in these ancient Plasmodium (i.e., P. falciparum, P. vivax, P. ovale, and P. practices, with several historic examples. malariae). Malaria remains a devastating global problem Jesuit priests reported in the seventeenth century that with 350-500 million cases reported and an estimates South America Indians used a tea-like drink prepared from one million deaths annually, 80% of them in sub-Saharan the bark of a native tree from Peru21 to treat some types Africa.29 Forty-nine percent of the world’s population of fever. In 1742, this tree was identified as Cinchona sp22 lives in risk areas (e.g., 109 countries in Africa, Asia, the (Rubiaceae) and in 1820 the alkaloid quinine was purified Middle East, Eastern Europe, Central America and South from the bark of Cinchona.22,23 A tea made from Artemisia America, the Caribbean, and Oceania).29 Another tropical annua (Asteraceae) has been used for treat intermittent disease with relevant importance regarding public health fevers in China since 168 B.C. In 1972, the active ingredient is leishmaniasis, a broad spectrum of parasitic diseases artemisinin, a sesquiterpene lactone with antimalarial caused by obligate intracellular protozoa.30-33 Leishmaniasis activity, was isolated from this plant. Indians from the north comprises two major forms: cutaneous, which causes skin and northeast of Brazil have used oil from Copaifera spp sores, and visceral, which affects internal organs of the (Fabaceae) since the 19th century to heal wounds and other body (e.g., spleen, liver, and bone marrow). It is estimated skin diseases, probably, based on observations of animals that 350 million people in approximately 90 countries rubbing on copaiba’s trunks.24 around the world are exposed to infection by Leishmania Traditional medicines are widely disseminated and it is and that some 1.5-2 million people are infected annually.34 estimated that 80% of the world´s population depends on In the Old World, leishmaniasis was common in Asia, the them as a primary health source.25 In Brazil, populations Middle East, Africa (particularly East and North Africa, of rural areas and forests rely on popular and traditional with some cases elsewhere), Southern European regions, medicine for treatment of many infectious diseases. Some but not in Australia or the South Pacific. In the Americas, species are included in prescriptions for therapeutic leishmaniasis occurs from Northern Mexico (seldom in the purposes such as the healing of wounds, inflammation Southern United States) to Northern Argentina; but not in due to microbial or parasitic infections, skin lesions, Chile, Uruguay and Canada. More than 90% of the world’s and ulcers.12 In some cases, the same plant may be used cases of cutaneous leishmaniasis are in Afghanistan, for different purposes.26 It is the general consensus that Algeria, Brazil, Iran, Iraq, Peru, Saudi Arabia and Syria, and traditional medical use of several biological sources 90% of the world’s cases of visceral leishmaniasis occur in indicates the presence of biologically active compounds. Bangladesh, Brazil, India, Nepal and Sudan.34 Bourdy et al.27 relate their experience over years with different ethnic groups from South America that showed 1.4 Malaria and leishmaniasis validated therapies that whenever a strong incidence of malaria is found, then half of the species related as “true” antimalarials had in The first choice treatments for these diseases are vitro and in vivo activity. In spite of that, Bourdy et al.27 based on a limited number of chemotherapeutic agents also related that harvesting season and different preparation characterized by high toxicity and cost, which have protocols in the laboratory lead to different results with made treatment inefficient since the 1980’s in many in vitro and in vivo models. Possibly, the inactivity or areas of high-transmission.35Quinine from Cinchona sp22 even poor activity reported in several scientific articles (Rubiaceae) was the drug most used to treat malaria until worldwide using different biological sources possess biased the First World War (1914-1918). During this conflict, new conclusions. molecules with antimalarial activity were synthesized, such as 9-aminoacrinidine (quinacrine, mepacrine) which was 1.3 Neglected diseases synthesized in the 1920’s and commercialized in 1930 under the name of atabrine.36 In 1944, quinine was synthesized in Leishmania and Plasmodium are protozoan parasites the laboratory,22 encouraging the development of several responsible for a spectrum of diseases known as drugs, among them the amodiaquine, primaquine and leishmaniasis and malaria. These diseases are classified chloroquine. These drugs are generally used to treat malaria 1014 Amazonian Biodiversity: A View of Drug Development for Leishmaniasis and Malaria J. Braz. Chem. Soc. due to their low cost, tolerance, safety in the treatment of in the development of antiparasitic drugs and as tools for pregnant women, lack of toxic effect in recommended the elucidation of important metabolic pathways of these doses, and high effectiveness in curing the disease.37,38 parasites. Extracts and purified secondary metabolites Chloroquine-resistant P. falciparum, first detected in 1961 obtained from plants belonging to the genus Abuta in Vietnam, was reported in several American soldiers,39 (Menispermaceae),65 Aspidosperma (Apocynaceae),62 motivating an intensive program of research for antimalarial Bidens (Asteraceae),63 Cinchona (Rubiaceae),64 Croton new agents. Dapsone and pyrimethamine/sulfadoxine were (Euphorbiaceae),65 Erythrina (Fabaceae),66 Picrolemma introduced in prophylaxis.21,40 Pyrimethamine was also (Simaroubaceae),62 Piper (Piperaceae),67 Pothomorphe sold in combination with sulfalene and with dapsone.41 (Piperaceae),62,68,69 Quassia (Simaroubaceae),70-72 Later on, two other highly effective compounds against Remijia (Rubiaceae),64 Simaba (Simaroubaceae),72,73 strains resistant to P. falciparum were approved by the Tabebuia (Bignoniaceae),74 Xylopia (Annonaceae),65 FDA: mefloquine42 and halofantrine.38,43 However, there and Zanthoxylum (Rutaceae),75 found in Amazonia, are reports of resistance to both compounds.44-46 Pentavalent presented effective antimalarial activity. Some of the most antimonials have been recommended for the treatment potent molecules against Plasmodium falciparum were of leishmaniasis for over 50 years.47 Unfortunately, obtained from the bark and roots of Amazonian species the treatment with these drugs leads to well-described belonging to these genera: neosergeolide, a terpenoid adverse reactions, and parasite resistance to these drugs quassinoid from Picrolemma sprucei (Simaroubaceae);62 is increasing in some areas, where limited or no efficacy simalikalactone D, a terpenoid quassinoid from Quassia is observed.48,49 Diamidine pentamidine and amphotericin amara (Simaroubaceae)71 and Simaba orinocensis B are used as second choices for leishmaniasis treatment. (Simaroubaceae);72 aspidocarpine, an alkaloid However, the use of these drugs is limited due to their from Aspidosperma desmanthum (Apocynaceae);62 toxicity or unconventional administration.50 Newer drugs, orinocinolide, a terpenoid quassinoid from Simaba such as the lipid formulations of amphotericin B, have been orinocensis (Simaroubaceae);72 and ellipticine, an alkaloid effective in the treatment of visceral leishmaniasis.47,51,52 from Aspidosperma vargasii (Apocynaceae).62 These Unfortunately, the prohibitive cost of the new formulations molecules present potent antimalarial activity against of this drug inhibit its use by the majority of patients with chloroquine-resistant Plasmodium falciparum in vitro visceral leishmaniasis.51 (IC = 1.0, 3.7, 7.0, 8.5, and 18.0 ng mL-1 respectively). 50 Drug intervention is the only mechanism of malaria Other purified molecules and extracts from the genera and leishmaniasis treatment approved by the World Annona (Annonaceae),76 Baccharis (Asteraceae),26 Health Organization. However, the chronic drug resistance Calophyllum (Clusiaceae),77 Cassia (Fabaceae),78 resulting from the recommended therapy, associated Copaifera (Fabaceae),79 Croton (Euphorbiaceae),80 with the collateral effects, has stimulated the search for Guatteria (Annonaceae),81 Jacaranda (Bignoniaceae),82 alternative treatments.30,31 In addition to this long-term Lippia (Verbenaceae),26 Piper (Piperaceae),83 Plectranthus therapy associated with toxic effects for both diseases (Lamiaceae),26 Stachytarpheta (Verbenaceae),84 and frequently leads to patients abandoning treatment, Pourouma (Moraceae),85 that also have Amazonian indicating the need for new drug searches. species, present effective antileishmanial activity. Secondary metabolites isolated from Annonaceae 1.5 Natural products from Amazonian biodiversity and their plants had leishmanicidal activity against different species potential in chemoterapy of neglected diseases of Leishmania. Berberine, a quaternary isoquinolinic alkaloid found in a number of plant families (Annonaceae, Among natural products, the alkaloids comprise the Berberidaceae, Menispermaceae), is one of the alkaloids largest single class of secondary plant metabolites. They with the highest leishmanicidal activity. This metabolite play an important role in plant defense against a variety is the main constituent in various folk remedies used in of microorganisms and animals, having a remarkable the treatment of cutaneous leishmaniasis, malaria and range of pharmacological activity. 19,53-57 These compounds amoebiasis.86 Berberine has been used clinically for the present an enormous structural diversity. Currently, several treatment of leishmaniasis and it has been demonstrated alkaloids58,59 and other isolated molecules55,60-62 have that it possesses significant activity both in vitro and in vivo biological activity against important parasites including against several species of Leishmania. At a concentration Leishmania sp and Plasmodium sp. These parasites are the of 10 µg mL-1 it effectively eliminates L. major parasites etiologic agents of the most important neglected diseases in peritoneal mice macrophages.86, 109,110 in the world. These molecules are promising candidates Species from the Annonaceae family have had their Vol. 20, No. 6, 2009 Calderon et al. 1015 alkaloids isolated and investigated for their leishmanicidal Another potential plant family, currently under activities. The isolated compound anonaine, an investigations, that presents important perspectives for isoquinoline alkaloid from the roots of Annona spinescens drug development is the Piperaceae family. These plants (Annonaceae), produces total lysis of promastigote forms are widely distributed in tropical and subtropical regions of L. amazonensis, L. braziliensis and L. donovani with 25, of the world, and are often used as food flavouring 50, and 100 µg mL-1 doses respectively.89 Liriodenine, an agents, in traditional medicines, and as pest control isoquinoline alkaloid from the roots and bark of Annona agents.94 Phytochemical research carried out with spinescens and Annona foetida (Annonaceae) exhibited Piper species revealed different classes of natural antileishmanial activity in vitro against promastigotes of products such as alkaloids, amides, cyclopentenedione L. braziliensis (IC = 34.8 µmol L-1).76 Isoguattouregidine, derivatives, dihydrochalcones, essential oils, flavonoids, 50 an isoquinolinic alkaloid isolated from the bark of Guatteria lignans, neolignans, and phenylpropanoids.94-102 The foliosa (Annonaceae), causes a total lysis of the parasites bioactive products of Piper have several biological of L. donovani and L. amazonensis when evaluated at a activities including anti-inflammatory, antimicrobial, concentration of 100 µmol L-1.89,112 antifungal, insecticidal and cytotoxic effects.103-106 The alkaloids xylopine and nornuciferine from Guatteria Thirteen benzoic acid derivatives isolated from Piper amplifolia (Annonaceae), and cryptodorine, nornantenine, glabratum (Piperaceae) and P. acutifolium (Piperaceae) isodomesticine, orisodomesticine, nantenine, and neolitsine were evaluated in vitro against the promastigote forms of from Guatteria dumetorum (Annonaceae) demonstrated Leishmania spp., Trypanosoma cruzi, and Plasmodium significant activity against Leishmania mexicana. Xylopine falciparum.67 Among the evaluated compounds, methyl was among the most active compounds (LD = 3 µmol L-1) 3,4-dihydroxy-5-(3’-methyl-2’-butenyl)benzoate exhibited 50 and showed a 37-fold higher toxicity towards L. mexicana the leishmanicidal effect (IC 13.8-18.5 µg mL-1) 50 than macrophages.90 Neolitsine effectively reduced the against the three Leishmania strains used, and methyl parasite growth at a concentration of 15 µmol L-1.81 3,4-dihydroxy-5-(2-hydroxy-3-methylbutenyl)benzoate, Rosa et al.80 investigated the leishmanicidal activity methyl 4-hydroxy-3-(2-hydroxy-3-methyl-3-butenyl) of the essential oil rich in the terpenic alcohol linalool benzoate, and methyl 3,4-dihydroxy-5-(3-methyl- extracted from Croton cajucara (Euphorbiaceae) against 2-butenyl)benzoate showed significant trypanocidal Leishmania amazonensis. The LD values of C. cajucara activity, with IC values of 16.4, 15.6, and 18.5 µg mL-1, 50 50 essential oil and purified linalool on the viability of respectively. 2’,6’-Dihydroxy-4’-methoxychalcone L. amazonensis promastigotes were 8.3 ng mL-1 for (DMC) purified from the dichloromethane extract of Piper essential oil and 4.3 ng mL-1 for purified linalool, and the aduncum inflorescences was active, in in vitro assays, LD for amastigotes were 22.0 ng mL-1 and 15.5 ng mL-1, against promastigotes and intracellular amastigotes of 50 respectively. These compounds have a potent leishmanicidal Leishmania amazonensis, with IC of 0.5 and 24 µg mL-1, 50 activity due to their disruption of flagellar membranes, respectively.107,108 In our laboratory, the screening for mitochondrial swelling, and damages in the organization compounds with antileishmanial activity from different of the nuclear and kinetoplast chromatins. The essential Piper species, P. permucromatum, P. tuberculatum, oils were not toxic to mammalian cells and increased nitric P. hispidum and P. renintens has proved worthwhile in oxide production by mouse peritoneal macrophages.80 bioassays against promastigote forms of Leishmania Species of the Copaifera genus (Fabaceae) are spp. (paper in preparation). Despite the effort of some important medicinal plants of the Amazonian region. research groups to study natural products obtained from the They supply an oil, known as copaiba oil or balsam of Amazonian forest, we could not find subsequent studies of copaiba, widely commercialized all over Brazil due to clinical trials reported in the literature reviwed regarding its anti-inflammatory and healing agent properties, as the above compounds. has been acknowledged for centuries.91-93 Trypanocidal and leishmanicidal activities of the copaiba oils were 1.6 Peptides from Amazonian anuran fauna mentioned in some ethnopharmacological studies.91,92 Santos et al.24 screened eight different kinds of Brazilian The Amazon forest includes the highest number of the copaiba oils for antileishmanial activity. Oil from anuran species of the world.109 The anuran skin presents Copaifera reticulata had activity against promastigote, morphofunctional and behavioral protective adaptations axenic amastigote and intracellular amastigote forms of against a number of adverse factors in the terrestrial Leishmania amazonensis, with IC values of 5, 15, and environment.110 The venom gland produces noxious or 50 20 µg mL-1, respectively.24 toxic secretions, which are rich in substances with a variety 1016 Amazonian Biodiversity: A View of Drug Development for Leishmaniasis and Malaria J. Braz. Chem. Soc. of pharmacological effects.110 The complex chemical skin reduce to non-detectable levels the promastigote composition of the anuran skin secretions constitutes a forms of Leishmania amazonensis at concentrations source of biologically active compounds against bacteria, of near 64 µg mL-1 after 2 and 6 hour of incubation.120 fungi and protozoa.111 Many of these molecules are known These results clearly indicate an increased interest as antimicrobial peptides (AMPs). The emerging drug in AMPs with leishmanicidal activity. Moreover, the resistance of pathogenic microorganisms has stimulated anuran AMP dermaseptin S4 and its derivatives were the interest in the development of antimicrobial peptides from only anuran AMPs tested in vitro against Plasmodium anuran skin as therapeutic agents.111 Antimicrobial peptides falciparum displaying a considerable effectiveness compose the innate immunity system of anurans against (IC of 7.7 µmol L-1 for dermaseptin S4 and 5.3 µmol L-1 50 microbial invasion.112-114 Crafted by evolution into an for the derivate NC7-P at the ring stage, and 3.4 µmol L-1 extremely diversified array of sequences and folds, AMPs and 6.2 µmol L-1, respectively, for the trophozoite stage).126 do share a common amphiphilic 3-D arrangement.114 This Dermaseptin S4 kills the intraerythrocytic malaria parasites feature is directly linked to a common mechanism of action through the lysis of the host cells, but its derivatives kill that predominantly develops upon interaction of peptides the parasite without lysing the erythrocyte.126,127 However, with cell membranes of target cells.114 The mechanisms of none of these peptides have been tested in vivo or against action of AMPs in parasite membranes are complex and naturally acquired leishmaniasis or malaria. unknown, but they constitute a promising and attractive proposition as new antileishmanial and antimalarial 1.7 The complexity of new chemical entity (NCE) therapeutics. The AMP mechanisms of interaction with development through Amazonian biodiversity the membrane are very complex. This complexity inhibits a fast adaptation of parasites, requiring a change in its Designing a new drug to market is a time-consuming membrane structure or composition, in contrast to drugs and expensive process for pharmaceutical companies, which of intracellular action.115 need to identify potential targets, screening and development Several anuran AMPs had leishmanicidal activity in order to maintain a competitive edge: technologies that against different species of Leishmania (Table 1).117,118 require specialized expertise and infrastructure that are These include the skin peptide YY (Skin-PYY) from largely concentrated in pharmaceutical industries and are Phyllomedusa bicolor (Amazon region),119 dermaseptin lacking in malaria and leishmania endemic countries. hypo01 (DShypo 01) from Phyllomedusa hypochondrialis Successful drug discovery efforts include biochemical, (South America including Amazon region),120 dermaseptin biophysical, genetic, pharmacological and immunological S4 (DS IV) from Phyllomedusa sauvagii (Chacoan humoral and cytological approaches, targeting such region) and its derivatives,121-123 dermasepin 01 (DS 01) processes as signal transduction, cell cycle control, from Phyllomedusa oreades (Cerrado region, Brazil),120 apoptosis, gene regulation, metastasis, and for malaria and magainin 2 from Xenopus laevis (Central and south leishmaniasis, the cell toxicity is highly relevant. The modern Africa),124 and temporins A and B from Rana temporaria approaches for drug development combines a widespread use (Europe).125 Skin polypetide YY from Amazon P. bicolor of combinatorial chemistry,128,129 high-throughput screening skin reduces the viability of promastigote forms of (HTS)130 associated with bioinformatics,131 crystallographic Leishmania major after one hour incubation at 25 µg mL-1.119 data132 and molecular-molecular docking interaction.133 The Dermaseptin hypo01 from Amazon P. hypochondrialis HTS assays could be accomplished from synthetic molecules Table 1. Anuran antimicrobial peptides with leishmanicidal activity Specie Peptide Sequence P. bicolor Skin-PYY YPPKPESPGEDASPEEMNKYLTALRHYINLVTRQRY P. hypochondrialis DShypo 01 GLWSTIKNVGKEAAIAAGKAALGAL P. oreades DS 01 GLWSTIKQKGKEAAIAAAKAAGQAALGAL P. sauvagii DS IV * ALWMTLLKKVLKAAAKALNAVLVGANA X. laevis Magainin-2 GIGKFLHSAKKFGKAFVGEIMNS R. temporaria Temporin-A FLPLIGRVLSGIL Temporin-B LLPIVGNLLKSLL * Dermaseptin S4 from Phyllomedusa sauvagii also presents activity against Plasmodium falciparum. Vol. 20, No. 6, 2009 Calderon et al. 1017 already registered in data banks134-138 or natural products these technologies are well implemented mainly in the (extracts or purified molecules) from biodiversity.19,139 In pharmaceutical industries of developed countries, or are spite of the traditional impact of naturally derived medicines restricted to some Universities and Research Institutes. and the incredible success stories of natural products (NPs) The huge biodiversity within the Brazilian territory as drugs from the commencement of human therapeutic puts the country in a strategic position to rationally and activity to modern research and drug development, most large sustainably explore NCEs for malaria, leishmaniasis and pharmaceutical companies have scaled down or terminated many other neglected or chronic diseases that possess high their work in natural products research.140 Some authors, pharmaceutical commercial speculation. In the future, based on statistical data, argue that the rational search of perspectives for drug design for malaria and leishmaniasis NPs from biodiversity is more advantageous than searching should focus on searching for specific parasite metabolic synthetic molecular data bases138-142 since they often display route inhibition through plant extracts and animal venoms or both unique biological properties and a challenging structural secretions screening by HTS and combinatorial chemistry. complexity. For example, the broad capacity of secondary The basis for sustained exploration of biodiversity relies on metabolism molecules found in the plants and animal clonal propagations, seed banks for preservation of genetic venoms have provided defense from infectious attacks of diversity145,146 or sustained animal contentions in captivity, microorganisms for thousands of years.143 i.e., if a plant/animal extract strongly binds to an enzymatic Drug design by combinatorial chemistry and HTS target, studies on the propagation of the species to supply created a large demand for small organic molecules that act biomass for extraction, fractionation and purification of on specific drug targets. These technologies focus on the the active metabolite(s) must initiate as soon as possible. generation of a huge number of molecules integrated with However, the Amazonian biodiversity is poorly explored biological screening from a very large number of samples.137 for NCE development. One of the reasons for this poor An increasing pressure to reduce drug development time exploration is the lack of enough research institutions and and cost by the pharmaceutical industries has stimulated the qualified scientists in the Amazon region. This structural search for relevant new molecules for commercially viable problem associated with the biodiversity access legal diseases such as cancer, cardiovascular, neural diseases and bureaucracy, mainly in national reserves and indigenous hospital infections but not for neglected diseases, which nation’s areas, creates strong hurdles to scientific exploration are not profitable. Even so, the pathway to be covered to and development of the NP potential of the Amazon forest. validate a new drug from a new chemical entity (NCE) is exhaustive. In order to make it, the NCE must pass through 2. Final Considerations a series of hurdles. The initial set of hurdles to overcome is passing from the different drug discovery stages to the Amazonian biomolecular diversity has a huge potential preclinical phase (see Table 2).144 Combinatorial chemistry as a source of molecules with biological activity against and HTS are the technologies necessary to overcome the Leishmania sp and Plasmodium sp. But it still remains an discovery phase obstacles listed in Table 2. Unfortunately, underexplored resource. This fact is evidenced by the large- Table 2. The drug discovery and development process with a short definition of each stage. The processes are more complex than presented and additional programs such as scale up and process chemistry, statistical analysis as well as dossier preparation are important parts of the process (extracted from Nwaka, 2003143 with copyright permission from authors) Level Stage Activity Discovery Target ID/validation Find and analyze a protein target or process that can affect the outcome of disease if perturbed Assay development Develop a method of finding what perturbs/inhibits the target HTS Screening Test a collection of molecules to find ones that have activity Hit-to lead Run further tests on selected molecules and begin optimization Lead optimization Optimize molecules for relevant pharmaceutical activity Preclinical Test molecules in animal model Development Phase I Determine safety and dosing of the drug in humans Phase II Obtain proof of concept of drug efficacy in humans Phase III Characterize drug extensively in large scale human trials Registration File a new drug application with regulatory authorities 1018 Amazonian Biodiversity: A View of Drug Development for Leishmaniasis and Malaria J. Braz. Chem. Soc. scale identification of compounds with antileishmanic and Acknowledgments antimalaric activity from animal and plant species in other biomes of the world with minor biodiversity while Amazonian The authors are grateful to the Ministry of Science and correlated species remain without research. But why does Technology (MCT), CNPq and FINEP and to the Secretary this region remain as an underexplored biomolecular source? of Development of the Rondonia State (PRONEX/CNPq) The answer to why the scientific approach is incompatible for financial support. with the volume of species in the Amazon region relates to geographical factors, and structural and legal problems. Leonardo de Azevedo Calderon The Amazon region encompasses seven million square was born in Brasília, Brazil, in kilometers (1.7 billion acres), of which five and a half 1976; he obtained his Bachelor million square kilometers (1.4 billion acres) are covered (2000) and PhD (2004) degrees in by the rainforest. This region includes territory belonging Biological Sciences at the University to nine nations and many areas are of difficult access and of Brasília – UnB, Brazil. He was full residence. Among the structural problems is the number of time professor at the Biological and researchers in the Amazon: according to the Coordenação Natural Sciences Center – CCBN de Aperfeiçoamento de Pessoal de Nível Superior (CAPES/ at the Federal University of Acre – MEC), up to 2005 only one thousand PhDs were working UFAC from 2006 until 2008. Since 2008 he is full time in the Brazilian Amazon area,146 very few in proportion professor and researcher of the Medicine College and to the size of the area, which represents 60% of Brazilian the Postgraduate program in Experimental Biology of territory. The number of properly equipped laboratories is the Health Center at the Federal University of Rondonia even smaller, probably not more than 20 to 50. The third – UNIR, where he composes the research group of the problem to the strong barrier against the development of Center of Applied Biomolecular Studies in Medicine – research in the Amazon is the Brazilian legal framework. CEBio. His research interest focuses physical-chemical and The legal bureaucracy discourages and chases away scientific thermodynamic characterization of bioactive molecules initiatives in the region. This problem is so serious that it from the Amazonian biodiversity with potential application prevents the implementation of scientific projects funded in the development of drugs for neglected diseases. from the government budget and implemented by officials of the government itself. To reverse this situation concerning Izaltina Silva-Jardim was born in the molecular diversity description of the Amazonian 1977. She graduated in Biological rainforest, as a way of subsidizing the development of drugs Sciences at the Federal University of to be applied to leishmaniasis and malaria, it is necessary Minas Gerais – UFMG (1999). She to associate conventional phytochemistry methods, HTS obtained her Master in Basic and and combinatorial chemistry from both research institutes Applied Immunolgy (2001) and PhD and industry and they must be supported by rational degree in Biochemistry (2005) at the governmental policies including financial and legal efforts University of São Paulo – USP. Since to minimize the structural and bureaucratic barriers. 2005 she is a researcher at Institute The creation of the Biodiversity and Biotechnology Web of Research in Tropical Disease – IPEPATRO and a visitant of the Legal Amazonia (Rede Bionorte) by the Brazilian professor at Federal University of Rondônia – UNIR. Her Minister of Science e Technology is a very good example research focuses in chemotherapy for leishmaniasis. of public policy for Amazonian NCE exploration. This web has the objective of coordinating and generating financial Juliana Pavan Zuliani has degree in support for research projects to be developed in Amazonia Dentistry from the University of the only by existing regional institutions and research groups. Sacred Heart (1997), specialization The incentive politics to finance projects can be the first in Dental Imaging at the Faculty of step to stimulate the scientific development of this region Dentistry of Piracicaba – UNICAMP through the implantation of new institutions of research and (2003), Masters (2001) and PhD the reinforcement of those already existing. The Bionorte (2005) in Immunology at the Institute web is an important way of Amazonian biodiversity of Biomedical Sciences of University preservation and its model should be adjusted for others of Sao Paulo – ICB/USP. In, 2003 strategic scientific and political areas for Amazonian she became a scientist at Butantan Institute until 2007. In, development. 2006 she moved to Rondonia as a visiting scientist in the Vol. 20, No. 6, 2009 Calderon et al. 1019 group of Dr. Luiz Hildebrando Pereira da Silva and Dr. Pessoa and later as Full Professor and Epidemiologist of Rodrigo G. Stabeli at the Institute of Research in Tropical the National Service of Malaria. In 1956, he was Professor Disease – IPEPATRO and in 2007 she became a scientist of of Parasitology of the Medicine College of University of São IPEPATRO, assistant professor of the course of Medicine of Paulo - USP. Dismissed by the Institutional Act of the Military the Federal University of Rondonia – UNIR and professor Government in 9 April 1964, he went to France where he was of the postgraduate course in Experimental Biology of the nominated Head of Research in the CNRS and came back Health Center, Federal University of Rondonia – UNIR. She work in the Unit of Genetique Microbienne of the Pasteur has experience in the area of immunology, with emphasis Institute, Paris, under supervision of Professor François on Cell Immunology and Immunopharmacology, working Jacob. He came back to Brazil in 1968 and was nominated mainly in the pro-inflammatory mechanisms of animal Professor of Genetics in the College of Medicine of USP, venoms, isolated toxins, and natural products. Ribeirão Preto. However, he was dismissed again for the Institutional Act n. 5 in 13 December 1969. Coming back to Alexandre de Almeida e Silva France and to the Pasteur Institute, Doctor Pereira da Silva graduated in Biology (1995) and worked until his retirement in 1996. During this period, he accomplished his PhD in Entomology obtained success in his career being Research and Director (2004) at the University of São of Research at CNRS, Professor of the Pasteur Institute, Paulo. After he moved to Porto Director of the Differentiation Cellular, Experimental Velho-RO in 2005, his researches Parasitology units, Head of the Departments of Molecular focused in the biology, ecology of Biology and Immunology, respectfully, Visiting Professor of mosquitoes, mainly, anophelines and Genetics in the Harvard University (1982). He came back to also the potential larvicidal effects of Brazil in 1997 and moved for Porto Velho, Rondonia where Amazonian biodiversity. Currently, he is professor at the he created the Institute of Research in Tropical Diseases Departament of Biology - Federal University of Rondonia, (IPEPATRO). Currently, Dr. Pereira da Silva is Main Brazil. Director of IPEPATRO, Emeriti Professor of the Federal University of Rondonia, Emeriti Professor of the University Pietro Ciancaglini was born in of São Paulo and Titular Member of Brazilian Academy Como, Italy, in 1963. He graduated of Science. He possess interest in molecular Biology and in Chemistry (1985) at the Chemistry epidemiology of parasitizes, tropical disease, immunology Department at FFCLRP of the São and infection of the neglected diseases. Paulo University (USP). He got his Master (1989) and PhD (1993) Rodrigo Guerino Stábeli was born degrees in Science at the Biochemistry in Ribeirão Preto, São Paulo State, Department at FMRP-USP. He was Brazil, in 1977. He graduated in Assistant Professor/Researcher of the Biological Science (1998) and PhD Chemistry Department of the FFCLRP-USP from 1995 up (2003) at the Medicine College to 2001 and Associated Professor/Researcher from then of Ribeirão Preto (FMRP), São on. Research Fields: Biomimetical systems: construction Paulo University. In 2003, he was of synthetic membranes to reconstitute membrane proteins. Visiting Professor of the Biochemistry Author of 63 scientific publications, one patent, and Department of the FMRP. In 2004, more than 180 scientific contributions to national and he moved for Porto Velho, Rondonia, Brazil and he became international congresses. Head of the Laboratory of Biochemistry and Biotechnology of the Institute of Research in Tropical Diseases (IPEPATRO). Luiz Hildebrando Pereira da Silva In 2005, he got his Post-doc degree, became Full Professor was born in Santos, São Paulo, of the Medicine College of Federal University of Rondonia, Brazil, in 1928. He graduated in and was appointed Scientific Director of the IPEPATRO. Medicine (1953), PhD (1960) and In 2008, he has elected Affiliated Member of Brazilian Full Habilitation in Parasitlogy Academy of Science and created the Center of Applied (1961) at the São Paulo University Biomolecular Studies in Medicine “Professor Dr. José - USP. He was professor of the Roberto Giglio” – CEBio of the Federal University of Medicine College at the Federal Rondonia. Currently Rodrigo Stábeli is coordinator of the University of Paraiba as assistant of the Professor Samuel Morphology and Physiology Department of the College