loading

Logout succeed

Logout succeed. See you again!

ebook img

A new photopolymer based VPHG for astronomy: The case of SN 2013fj PDF

file size0.73 MB

Preview A new photopolymer based VPHG for astronomy: The case of SN 2013fj

A new photopolymer based VPHG for astronomy: The case of SN 2013fj Alessio Zanutta, Marco Landoni, Andrea Bianco 4 1 INAF - Osservatorio Astronomico di Brera, Via Emilio Bianchi 46, I-23807 Merate, Italy 0 2 Lina Tomasella, Stefano Benetti, Enrico Giro n a INAF - Osservatorio Astronomico di Padova, Vicolo dell’Osservatorio 5, I-35122 Padova, Italy J 1 3 ] ABSTRACT M The spectroscopic studies of near infrared emission arising from supernovae allow to derive I . crucialquantitiesthatcouldbettercharacterisephysicalconditionsoftheexpandinggas,suchas h p the CaII IR HVF spectral feature. For this reasonis mandatory to have Diffractive Optical Ele- - ments(DOEs)withaspectralcoverageinthe range8000- 10000˚A(for lowzsources)combined o withareasonableSignaltoNoiseRatio(S/N)andmedium-lowresolution. Inorderto copewith r t all of those requirements we developed a Volume Phase Holographic Grating (VPHG) based on s a aninnovativephotosensitivematerial,developedbyBayerMaterialScience. Wedemonstratedthe [ capabilitiesofthisnewDOEthroughobservationofSN2013fjascasestudyatAsiagoCopernico Telescope where AFOSC spectrograph is available. 1 v Subjectheadings: SupernovaeIa;extragalacticastronomy;volumephaseholographicgrating;photopoly- 5 mers; grism 1 0 0 1. Introduction a periodic modulation (usually sinusoidal) of the . refractive index written in the holographic ma- 2 Astronomicalspectrographsarekeyinstrumen- terial. Hence the fundamental parameters that 0 tationtotackletheopenissuesinastronomy. One 4 rule the overall efficiency of such devices are 1 of the most important element along with the the thickness of the active film and the modu- : detector is the dispersing element. In the last lation of the refractive index inside it. VPHG v 15 years, the Volume Phase Holographic Grating i technology has been applied in different astro- X (VPHG) technologyhasgaineda lotofinterestin nomical spectrographs, at room and cryogenic r astronomical field and it has been used in some temperatures (Bershady et al. 2008; Arns et al. a spectrographs (Baldry et al. 2004; Bianco et al. 2010; Molinari et al. 2004; Lepine et al. 2003; 2012; Barden et al. 2000; Pazder & Clemens Hou et al. 2010; Renault et al. 2010; Hill et al. 2008). The reasons for such interest stem from 2008). Theyhavealsobeenusedastuneablefilters the fact that these gratings show unique features, and cross dispersers (Mendes de Oliveira et al. such as i) the high peak efficiency (up to 100% 2013; Gibson et al. 2012; Castilho et al. 2004). theoretically) both at low and large dispersion; The VPHGs assembledin aGRISM configuration ii) the ease of performance tuning and customisa- have been also used in this kind of instrumenta- tion (each VPHG is a master grating). A VPHG tion. The availability of a low resolution grism consists in a thin layer of holographic material, covering the red part of the optical spectrum is usuallydichromatedgelatine(Bianco et al. 2012; of paramount importance for several astrophysi- Barden et al. 2000),whichissandwichedbetween cal targets, among which stands out the study of two glass windows. The phase of incident light is supernovae in general and type Ia supernovae in modified passing through the gratings thanks to 1 particular. Sucha grismwill characterisethe evo- FOCAS (Ebizuka et al. 2011a,b). Starting from lution of important lines during the photospheric the scientific case of the SN 2013fj hereinafter we (e.g. O I 7774 ˚A and Ca II IR triplet), and the demonstrate the capabilities in terms of spectral nebular phases (e.g. Ca II] 7291-7323 ˚A and Ca resolution and throughput of this new family of II IR triplet). VolumePhaseHolographicGrating,basedonpho- Particularly important will be to study the evo- topolymers, comparing two spectra of SN 2013fj lution in type Ia supernovae of the high velocity in which one of them is secured by the adop- features (HVFs) seen in the Ca II triplet pro- tion of previous existing state of the art grating. file, especially at early,pre-maximum,phases (see Throughoutthispaperwerefertothisnewgrating Childress et al. 2014, for a recent review). The as VPH6. origin of the HVFs remains unknown, but dif- ferent hypotheses have been proposed, which in- 2. Observations and data reduction clude the impact of the ejecta with a circumstel- We obtained the spectrum of SN 2013fj in lar shell lost by the progenitor before the explo- visitor mode at Ekar Asiago Observatory using sion (see Gerardy et al. 2004); an enhancement the Asiago Faint Object Spectrograph Camera in the abundance of intermediate-mass elements (AFOSC) on 13th September 2013. The seeing (IMEs) in the outermost layers of SN Ia ejecta ′′ during the night was quite constant (2.0 - 2.2 ) (Mazzali et al. 2005a,b; Tanaka et al. 2008); or and the sky was almost clear during the obser- variations in the ionisation state of IMEs in the vations. In order to compare the new VPH6 de- outerlayersofSNIaejecta(Blondin et al. 2013). vice performance, we took two spectrum of the It is evident that the study of the Ca II HVFs SN 2013fj. The first one was been obtained con- could have a big impact in deriving the true pro- figuring the instrument with the GRISM GR04, genitor scenario involved in the SNIa explosion, yielding a dispersion of ∼ 5 ˚A px−1 and R ∼ 600 which in turn could have important implication in the spectral range 3500-7500 ˚A. The spectra in the use of SNIa in Cosmology. Moreover, the obtained with the new VPH6 GRISM, which was circumstellar (CS) material responsible for the been secured immediately after the previous one, HVFs could cause subtle alteration of the spec- yields a dispersion of ∼ 3.5 ˚A px−1 and R ∼ 500. tralenergydistributionofSNIa,whichcouldhave We adopted a slit of 1.69′′ × 5.00′′ for both spec- possible consequences in the luminosity standard- tra. ization of SNIa (Childress et al. 2014). Since the Supernova Program has many observa- In order to accomplish the desired requirements tionprioritiesscheduledforAFOSC,wedecidedto we designed and manufactured a VPHG based firstsecureaspectrumwiththe wellknownGR04 on a completely new holographic material. The grating (this was done to guarantee the data for study ofthis newmaterial,otherthandichromate the requiredscientific tasks). After that we coped gelatins (DCGs), is very important in order to to obtain another observation of the same target make possible the design and manufacturing of (SN2013fj),underthesameskyconditions,reduc- innovative and large VPHGs. Indeed DCGs are ingthetelescopetimethatwouldbeotherwisenot difficult to handle, they require a complex chem- allocated for the other targets in the night. The ical process and the scalability to very large size integration time for the spectrum obtained with gratings can be an issue. For this reasons we fo- VPH6 was 1200s while for the GR04 was 1800s. cused the attention to solid photopolymers which Foreachexposurewereduceddataadoptingstan- combines high throughput, high refractive index dard IRAF1 procedure. We performed bias sub- modulation, self developing (i.e. no chemical pro- tractionandflatfieldcorrectionfor eachscientific cesses needed) and size scalability. Such new ma- frame adopting calibration obtained in the same terial belongs to the class of solid photopolymers night. The wavelength calibration was achieved and this is the first time, in our knowledge, that this kind of holographic material has been used 1IRAF (Image Reduction and Analysis Facility) is dis- to make scientific grade dispersing elements. In tributedbytheNationalOpticalAstronomyObservatories, thepastonlyliquidphotopolymershavebeenused which are operated by the Association of Universities for oncetoproduceVPHGsmountedinMOIRCSand ResearchinAstronomy,Inc.,undercooperativeagreement withtheNationalScienceFoundation. 2 using the spectra of standard arcs (Th-Ar and 2.1. The device VPH6 at AFOSC Hg-Cd) while flux calibration has been assessed The GRISM consists in a photopolymer based through relative photometric calibration of stan- Volume Phase Holographic Grating (VPHG) (see dard stars spectra (Oke 1990) obtained in the Table 1 for the GRISM features and require- same night (BD+33d2642). The accuracy on ments). The solid photopolymer used in this wavelength calibration is ∼ 0.5 ˚A rms for the device has been recently developed by Bayer VPH6 and ∼ 0.2 ˚A rms for the GR04. MaterialScience AG (product family: Bayfol(cid:13)R ThetwoRMSvaluesfortheaccuracyonthewave- HX) as high performance holographic material length calibration are quite different since in the (Bruder et al. 2010), for reflection holograms. red partof the spectrum few comparisonlines are Thematerialisalsosuitablefortransmissionholo- available due to the calibration lamps installed in grams with high dynamic range and sensitivity. theAFOSCspectrograph. Thecalibrationismore Moreover the material is laminated onto flexible accurate in the blue because more emission lines and transparent substrates of large sizes. The in thatpartof the spectrum wereusable. For this grating is a ”low dispersion” device with a line reason, the two RMS are slightly different. How- density of 285 lines mm−1 with a targetefficiency ever,it is alsoimportant to note that the two val- of 90% at the central wavelength. ues are far below the resolution power of the two It can be seen that this low dispersion grating, gratings. TheapparentRmagnitudeobtainedwas combinedwithasuitablewavelengthrange,allows 17.2 ± 0.2. We cross checkedthe calculated value tocoverstheHαregionandtheCaIbumptypical throughanaperturephotometryoftheRbandac- ofSNspectra. Thedesignofthegratingwasaimed quisitionimage ofthe field(see Figure 1), secured at finding the best key parameters (film thickness just before obtaining the spectra. and refractive index modulation) matching the scientific requirements, i.e. diffraction efficiency, wavelength coverage, and resolution. This activ- ity has been performed through RCWA simula- tions2 (M. Moharam and T. Gaylord 1981). We havethereforeidentifiedthebestcoupleofparam- eters(∆n=0.011andd=34µm). Thequitelarge thickness and small modulation of the refractive index is chosen in order to reduce the efficiency inordershigherthanthe first,whichisa common featureoflowlinedensityVPHGs. InFigure2are reported the simulated 1-st order diffraction effi- ciency curves for different values of ∆n and film thickness. In the inset A) are reported the curves at different film thickness with with a fixed value of ∆n = 0.011. Shown curves have ± 10 % from the chosen value of 34 µm. In the inset B) are re- portedthecurvesatdifferent∆nwithwithafixed thickness d = 34 µm. Shown curves have ± 10 % fromthechosenvalueof0.011. Thephotosensitive Fig. 1.—RBandimageofFoVaroundSN2013fj. film was laminated onto a BK7 substrate before Theplatescaleoftheimageis18.59′′px−1. Expo- the exposure; the writing procedure was accom- sure time is 120s. Seeing during the observation, plished using a standard two-beams holographic taken at airmass 1.17 and measured on the image setup with a DPSS laser of 532 nm. The tar- ′′ of the field, is 2.2 . The host galaxy of SN 2013fj get refractive index modulation has been reached is also clearly visible. optimising the writing laser power since the fi- 2RCWAcode,writteninC,wasprovidedbyGaryBernstein, whoimplementedthemethods ofMoharam&Gaylord. 3 Table 1 AFOSC’s GRISM VPH6: main specifications and requirements λcentral [nm] linesmm−1 ∆λ[nm] ηpeak ηside (1) (2) (3) (4) (5) 800 285 620-980 90% 30% Note.—Descriptionofcolumns: (1) Workingcentralwavelengthofthegrating;(2) Pitchofthegrating; (3)Wavelengthrange;(4) 1-storderdiffractionefficiencyatthepeakwavelength;(5)1-storderdiffractionefficiencyatthewavelengthrangeedges. nal achieved∆n strongly depends upon the expo- sure power density as reported by Berneth et al. ° A) 1−st order diffraction efficency curves @ 4.4 (2011). different film thickness and fixed ∆ n 1 Regarding the GRISM, the apex prism angle has been designed in order to maintain the 1-st 0.8 order central undieviated wavelength at 800 nm. ◦ TheresultwasaBK7prismwithanangleof12.7 T tinhgatofco4r.r4e◦s.pond at an entrance angle in the grat- ciency − 1 00..46 333047. .µ64 µµm mm The grating was then coupled with the prisms us- effi ing a refractive index matching oil. In order to 0.2 characterise the device, we measured the diffrac- tion efficiency of the GRISM. The measurements 0 werecarriedoutusinglaserlightatdifferentwave- 0.5 0.6 0.7 0.8 0.9 1 λ [µ m] lengths, setting the p- or s- polarisation and col- lecting the efficiency of the first order as function ° B) 1−st order diffraction efficency curves @ 4.4 of the incidence angle; two efficiency curves are different ∆ n and fixed thickness 1 reported in Figure 3. It can be seen that the efficiency is very high 0.8 even with the prisms coupled with the VPHG in the GRISM structure. This is achievable thanks T to the AR-coating onto the prisms surfaces and y − 1 0.6 0.0099 c 0.011 n the use of the same substrate material for both cie 0.4 0.0121 the prisms and grating windows, that avoids fur- effi ther reflection losses. We lastly report in Figure 0.2 4 the measured1-storderdiffractionefficiency vs. wavelengthoftheGRISMalignedandmountedin 0 his housing. 0.5 0.6 0.7 0.8 0.9 1 λ [µ m] It is clear that the final alignment is crucial to maintain the requirements satisfied since even a tilt of a few degrees have a huge impact on the Fig. 2.— Simulated 1-st order diffraction effi- efficiency curve. ciencycurves,withRigorousCoupledWaveAnal- ysis; A) curves for different thickness (d = 34 µm 3. Results ± 10 %) and fixed ∆n = 0.011; B) curves for dif- After the commissioning of the new VPH6 for ferentrefractiveindex modulation(∆n = 0.011± AFOSC at 1.82m Copernico telescope, we taken 10 %) and d = 34 µm . The considered incidence ◦ two exposures of a flat field lamp with the same angle is 4.4 (on the grating interface). exposuretimebutvaryingthegratingsinorderto 4 have a sound comparison of the two overall effi- ciencies. In particular, as shown in Figure 5 the Wavelength = 808 nm spectra of the lamp represents the behaviour of 1 φ 1−st order diffraction efficiency0000....2468 max = 89% φmspean φ tttfsohhotarreeT,rtitchnshionlaseimgttnrstpkufwasrlmooorsetmesodenxta∼gtp,nhroiadne5stu8itthn0reeeog0rlesmmss˚A.icostogotpiehfseneeepffitonohuucsrsismoeiubncbglcoeehynrptfiooougfftuti,cnrhoaafeeutdridnooetpntsthteeaiocdnt-f 0 −15 −10 in−c5idence angle α [gr0ad] 5 10 the spectrum of the new device (red curve) is sig- nificantly higher than those obtained in the case Wavelength = 633 nm of the GR04 (blue curve). Moreover the spectral 1 1−st order diffraction efficiency0000....2468 max = 78% φφmspean φ ae(TwcTroshitvtoierheemerswqaatuogehsilfeeerlletlovahdVfiesetPiihtnbtHealaeo6rlV.rgfdPerwiet2Hnaer0sgd61tino4cios)gob.imenjoxevpfcteatetsnrhtfeideogderafldtwatehutietpnfiheSetaloNtdrh∼IerpRer9coo5opng0rrerd0oaepom˚Ad-f −01 5 −10 −5 0 5 10 the GR04 after the signal normalisation; the re- incidence angle α [grad] sult was a comparable fringe pattern, reassuring us that the effect can be attributed only to the Fig. 3.— Measured 1-st order diffraction efficien- CCD as described in the AFOSC’s manual. 3 cies of the GRISM at 808 nm and 633 nm. The datarepresentthep-polarisationefficiencyφ ,the p s-polarisationefficiencyφ andtheresultingmean s φ, as function of the incidence angle α in air. 1 0.9 0.8 1−st order diffraction efficiency00000.....34567 0−+°11°° Fig. 5.— Comparison of flat fields of VPH6 (red 0.2 line) and GR04 (blue line) obtained at AFOSC adopting homogeneous configuration of the sys- 0.1 tem. 0 600 650 700 750 800 850 900 950 1000 wavelength [nm] In order to assess the capabilities of the new Fig. 4.—Measured1-storderdiffractionefficiency grating in terms of scientific goals, we performed curve of the alignedGRISM at different incidence observations of SN 2013fj that has been al- angles. The angle 0◦ refers to the perpendicular ready discovered by the amateur astronomers to the grating inside the GRISM. 3The entire manual of AFOSC is available at http://archive.oapd.inaf.it/asiago/5000/5100/man01_2.ps.gz 5 Fig. 6.— Spectra of SN 2013fj taken with AFOSC and GR04 (blue line) and with VPH6 (red line). The principal lines of Si II, Ca II, S I, Mg II and Fe II are shown. 6 are the Ca II near-IR triplet. Despite contamina- tion from the 7600 ˚A telluric feature, O I 7774 ˚A is clearly visible. Adopting for the host galaxy (CGCG 428-62) of SN 2013fj a recessional velocity of 10064 km s−1, Huchra et al. (1999), an expansion velocity of about10700kms−1isdeducedfromtheSiII6355 ˚Aabsorption,whilefromtheCa-IIIRtripletmini- mumanexpansionvelocityofabout11500kms−1 is deduced (the velocity is relative to the average Ca-II IR triplet wavelength, 8579.1 ˚A). This be- Fig. 7.— Comparison of the SN 2013fj spectrum haviouristypicallyseeninSNIa,wherethestrong with that of phase +5 days from B maximum of CaII lines are formed well above the photosphere, SN1992AmadeusingtheGELATOtool;GEneric which is better traced by the weaker S-II lines classification Tool by Harutyunyan et al. (2008). (from which a mean expansion velocity of about GELATO is a software for objective classification 8400 km s−1 is deduced). of Supernova spectra and performs an automatic The CaII-IRhigh velocityfeature is by this phase comparisonofagivenspectrumwithasetofwell- very weak, see Mazzali et al. (2005b), but pos- studied SN spectra templates. Spectra of all SN sibly still visible as a weak absorption at about types fromPadova-AsiagoSNArchiveareusedas 23000 km s−1 templates for the comparison procedure. The expansion velocity deduced from the S-II 6355 ˚A minimum most probably places SN 2013fj among the low velocity gradient type Ia super- Ciabattari et al. (2013) members of the Ital- novae, following Benetti et al. (2005). ian Supernovae Search Project on 7th Septem- Inorderto makeasoundcomparisonbetweenthe ber 2013. The spectra reported in Figure 6 has two different dispersive elements, we evaluated been obtained 6.07 days later and is that typi- the S/N (Signal to Noise Ratio) at 6 different cal of a Type Ia supernova, about 5±2 days after wavelengths along the two obtained spectra. The maximum light (see Figure 7), confirming the es- results are reported in Table 2 where S/N of the timated phase reportedby Zanutta et al. (2013), GRISMshavebeennormalisedadoptingtheusual and derived from a fast reduction performed at S/N equation (Howell et al. 2006) taking into ac- the telescope of the same data. count the different exposure times.4 The recorded spectrum, reported in Figure 7 and analysedwithGELATO,isthecombinationofthe spectra taken with the new VPH6 and the 3500- 4. Conclusions 4750˚AregionoftheGR04(sincetheywelloverlap in the whole common range). This decision has We demonstrated the good performances ob- been made because of the evident better Signal tainable by using a Volume Phase Holographic to Noise Ratio of the VPH6 and the higher cov- Grating based on new photopolymer materials erage in the red region where the the important which are self developing, characterisedby a high featuresofthetargetobjectare(suchasHVFCa- sensitivityanddynamicrangeinconjunctionwith II IR). The spectrum exhibit the broad P-Cygni an easy processability. The GRISM has been de- lines typical of SNe Ia: the characteristic deep signed and manufactured in order to maximise absorption near 6150 ˚A due to Si II 6347, 6371 the efficiency reducing the reflection losses. For ˚A (hereafter Si II 6355 ˚A), the Si II 5958, 5979 these reasons such devices are a reliable alterna- ˚A feature (hereafter Si II 5972 ˚A), the W-shaped tive to classical VPHGs. We assessed the scien- feature near5400˚Aattributedto SII 5468˚Aand S II 5640 ˚A. 4Fortherenormalisationweassumedthattheequationsim- Other prominent features are Ca II H&K, Mg II plifiestoS/N =√s(wheresisthesignalfromthesource) 4481 ˚A, and several blends due to Fe II and Si II. sinceothernoises(suchasdarkcurrentordetectorreadout noise)arenegligibleatthislevelofcomparison. At red wavelengths, particularly strong features 7 Table 2 Signal to Noise Ratio comparison between the two GRISMs Wavelength[˚A] S/NofVPH6 S/NofGR04 5000 22 17 5500 42 27 6000 45 27 6500 57 27 7000 38 20 7500 30 13 Note.—TheS/NofthetwoGRISMshavebeennormalisedaccordingtotherespectiveexposuretimes. tific requirements which drawn the design of this new DOE by collectingthe spectrum ofthe newly discovered SN Ia PSN J22152851+1534041= SN 2013fj. Wefinallycarriedoutasoundcomparison with another spectrum of the same object under the same conditions, secured with the standard grismthatischaracterisedby the samedispersion and resolution. Acknowledgements We are grateful to: Dr. Thomas F¨acke of Bayer MaterialScience for providing the material and for the useful discussions; The technicians at mt. Ekar for all the support during commissioning basedonobservationscollectedatCopernicotele- scope (Asiago, Italy) of the INAF - Osservatorio Astronomico di Padova; L.T. and S.B. are par- tially supported by the PRIN-INAF 2011 with the project ”TransientUniverse: from ESO Large to PESSTO”. 8 REFERENCES Harutyunyan et al. 2008, A&A, 488, 383 Arns, J., Wilson, J. C., Skrutskie, M., et al. 2010, Hill, G. J., MacQueen, P. J., Smith, M. P., et al. Proc. SPIE, 7739 2008,Proc. SPIE, 7014 Baldry, I. K., Bland-Hawthorn, J., & Robertson, Hou, Y., Zhu, Y., Hu, Z., Wang, L., & Wang, J. J.G.2004,Publ.Astron.Soc.Pacific.,116,403 2010,Proc. SPIE, 7735 Barden, S. C., Arns, J. A., Colburn, W. S., & Howell, S. B., Ellis, R., Huchra, J., et al. 2006, Williams, J. B. 2000, PASP, 112, 809 Handbook of CCD astronomy, 2nd ed., by S.B. Howell. Cambridge observing handbooks Benetti, S., Cappellaro, E. , Mazzali, P.A., Tu- for research astronomers, Vol. 5 Cambridge, ratto,M.,Altavilla,G.,Bufano,F.,Elias-Rosa, UK: Cambridge University Press, 2006 ISBN N., Kotak, R., Pignata, G., Salvo, M., Stani- 0521852153 shev, V. 2005,ApJ, 623, 1011 Huchra et al. 1999, A.Ap. Suppl., 121, 287 Berneth, H., Bruder, F. K., F¨acke, T., Hagen, R., Ho¨nel, D., Jurbergs, D., Ro¨lle, T., & Weiser, Lepine, J. R. D., de Oliveira, A. C., Figueredo, M.-S. 2011, Proc. SPIE, 7957, 79570H M. V., et al. 2003,Proc. SPIE, 4841, 1086 Bershady, M., Barden, S., Blanche, P.-A., et al. Mazzali,P.A.,Benetti, S.,Stehle,M., etal.2005, 2008,Proc. SPIE, 7014 MNRAS, 357, 200 Paper A. Bianco,A., Pariani,G., Zanutta,A., &Bertarelli, Mazzali, P. A., Benetti, S., Altavilla, G., et al. C. 2012, Proc. SPIE, 8450 2005,ApJ, 623, L37 Paper B. Blondin, S., Dessart, L., Hillier, D. J., & Mendes de Oliveira, C., Taylor, K., Quint, B., et Khokhlov, A. M. 2013, MNRAS, 429, 2127 al. 2013, PASP, 125, 396 Bruder, F.-K., Deuber, F., F¨acke, T., Hagen, R., Moharam,M. & Gaylord,T. 1981,JOSA, 71,811 Ho¨nel, D., Jurbergs, D., Ro¨lle, T., & Weiser, M.-S. 2010, Proc. SPIE, 7619, 76190I Molinari,E.,Bianco,A.,Bertarelli,C.,etal.2004, Proc. SPIE, 5494, 228 Cardelli, J. A., Clayton, G. C., & Mathis, J. S. 1989,ApJ, 345, 245 Oke, J. B. 1990,AJ, 99, 1621 Castilho, B. V., Delabre, B., & Gneiding, C. D. Pazder,J.S., & Clemens, J. C. 2008,Proc.SPIE, 2004,Proc. SPIE, 5492, 433 7018 Childress, M. J., Filippenko, A. V., & Gane- Renault, E., Loupias, M., Adjali, L., et al. 2010, shalingam,M.,&SchmidtM.J.2014,MNRAS, Proc. SPIE, 7739 437, 338 Tanaka,M.,Mazzali,P.A.,Benetti,S.,etal.2008, Ciabattari,F.,Mazzoni,E.,Parker,S.,etal.2013, ApJ, 677, 448 Central Bureau Electronic Telegrams, 3654,1 Tomasella et al. 2014, Astron. Nachrichten, in Ebizuka, N., Ichiyama, K., Yamada, T., et al. preparation 2011,PASJ, 63, 605 Zanutta et al. 2013, CBET 3654 Ebizuka,N.,Kawabata,K.S.,Oka,K.,etal.2011, PASJ, 63, 613 Gerardy, C. L., Ho¨flich, P., Fesen, R. A., et al. 2004,ApJ, 607, 391 Gibson, S., Barnes, S. I., Hearnshaw, J., et al. This2-columnpreprintwaspreparedwiththeAASLATEX 2012,Proc. SPIE, 8446 macrosv5.2. 9

See more

The list of books you might like